NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10574.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10574.1 Public Homo sapiens 16 COQ7 22 109 92 CCDS HistoryNCBI Gene:10229Re-query CCDS DB by CCDS ID:10574.1Re-query CCDS DB by GeneID:10229See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10574.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000321998.9 ENSP00000322316.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000321998.9Link to Ensembl Protein Viewer:ENSP00000322316.5Re-query CCDS DB by Nucleotide ID:ENST00000321998Re-query CCDS DB by Protein ID:ENSP00000322316
Original member Current member EBI ENST00000568985.5 ENSP00000456734.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000568985.5Link to Ensembl Protein Viewer:ENSP00000456734.1Re-query CCDS DB by Nucleotide ID:ENST00000568985Re-query CCDS DB by Protein ID:ENSP00000456734
Original member NCBI NM_016138.4 NP_057222.2 Updated not alive Link to Nucleotide Sequence:NM_016138.4Link to Protein Sequence:NP_057222.2Re-query CCDS DB by Nucleotide ID:NM_016138Re-query CCDS DB by Protein ID:NP_057222
Current member NCBI NM_016138.5 NP_057222.2 Accepted alive Link to Nucleotide Sequence:NM_016138.5Link to Protein Sequence:NP_057222.2Re-query CCDS DB by Nucleotide ID:NM_016138Re-query CCDS DB by Protein ID:NP_057222Link to BLAST:NP_057222.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057222.2 217 Q99807-1 217 100% 0 0

Chromosomal Locations for CCDS 10574.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 19067665 19067737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 19071928 19072106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 19073921 19074035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 19075721 19075860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 19077306 19077374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 19078081 19078158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (654 nt):
ATGAGTTGCGCCGGGGCGGCGGCGGCTCCCCGCCTTTGGCGGCTGCGCCCGGGGGCCCGGCGGTCCCTCT
CA
GCTTATGGAAGAAGAACCAGTGTCAGATTTCGCAGTTCAGGAATGACTTTAGACAATATCAGTCGGGC
A
GCTGTGGATCGAATAATCCGGGTGGATCATGCAGGCGAATATGGAGCAAACCGCATCTATGCCGGGCAG
ATG
GCTGTCCTGGGTCGGACCAGCGTCGGGCCAGTCATTCAGAAAATGTGGGATCAAGAAAAGGACCATT
TG
AAAAAGTTCAATGAGTTGATGGTTACGTTCAGGGTCCGGCCAACAGTTCTGATGCCCTTGTGGAACGT
G
CTGGGGTTTGCACTGGGGGCGGGGACCGCCTTGCTCGGGAAGGAAGGTGCCATGGCCTGCACCGTGGCG
GTG
GAAGAGAGCATAGCACATCACTACAACAACCAGATCAGGACGCTGATGGAGGAGGACCCTGAAAAAT
AC
GAGGAACTTCTTCAGCTGATAAAGAAATTTCGGGATGAAGAGCTTGAGCACCATGACATAGGCCTCGA
C
CATGATGCAGAATTGGCTCCAGCCTATGCCGTCCTGAAGAGCATTATCCAGGCCGGATGCAGAGTGGCG
ATA
TATTTATCAGAAAGATTATAA


Translation (217 aa):
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ
M
AVLGRTSVGPVIQ
KMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA
V
EESIAHHYNNQIRTLMEEDPEKYEELLQ
LIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA
I
YLSERL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser