NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10534.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10534.1 Public Homo sapiens 16 ABAT 22 109 92 CCDS HistoryNCBI Gene:18Re-query CCDS DB by CCDS ID:10534.1Re-query CCDS DB by GeneID:18See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10534.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000268251.12 ENSP00000268251.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268251.12Link to Ensembl Protein Viewer:ENSP00000268251.8Re-query CCDS DB by Nucleotide ID:ENST00000268251Re-query CCDS DB by Protein ID:ENSP00000268251
Original member Current member EBI ENST00000396600.6 ENSP00000379845.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396600.6Link to Ensembl Protein Viewer:ENSP00000379845.2Re-query CCDS DB by Nucleotide ID:ENST00000396600Re-query CCDS DB by Protein ID:ENSP00000379845
Original member Current member EBI ENST00000425191.6 ENSP00000411916.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000425191.6Link to Ensembl Protein Viewer:ENSP00000411916.2Re-query CCDS DB by Nucleotide ID:ENST00000425191Re-query CCDS DB by Protein ID:ENSP00000411916
Original member NCBI NM_000663.4 NP_000654.2 Updated not alive Link to Nucleotide Sequence:NM_000663.4Link to Protein Sequence:NP_000654.2Re-query CCDS DB by Nucleotide ID:NM_000663Re-query CCDS DB by Protein ID:NP_000654
Current member NCBI NM_000663.5 NP_000654.2 Accepted alive Link to Nucleotide Sequence:NM_000663.5Link to Protein Sequence:NP_000654.2Re-query CCDS DB by Nucleotide ID:NM_000663Re-query CCDS DB by Protein ID:NP_000654Link to BLAST:NP_000654.2
Original member NCBI NM_001127448.1 NP_001120920.1 Updated not alive Link to Nucleotide Sequence:NM_001127448.1Link to Protein Sequence:NP_001120920.1Re-query CCDS DB by Nucleotide ID:NM_001127448Re-query CCDS DB by Protein ID:NP_001120920
Current member NCBI NM_001127448.2 NP_001120920.1 Accepted alive Link to Nucleotide Sequence:NM_001127448.2Link to Protein Sequence:NP_001120920.1Re-query CCDS DB by Nucleotide ID:NM_001127448Re-query CCDS DB by Protein ID:NP_001120920Link to BLAST:NP_001120920.1
Original member NCBI NM_020686.5 NP_065737.2 Updated not alive Link to Nucleotide Sequence:NM_020686.5Link to Protein Sequence:NP_065737.2Re-query CCDS DB by Nucleotide ID:NM_020686Re-query CCDS DB by Protein ID:NP_065737
Current member NCBI NM_020686.6 NP_065737.2 Accepted alive Link to Nucleotide Sequence:NM_020686.6Link to Protein Sequence:NP_065737.2Re-query CCDS DB by Nucleotide ID:NM_020686Re-query CCDS DB by Protein ID:NP_065737Link to BLAST:NP_065737.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000654.2 500 P80404 500 100% 0 0
NP_001120920.1 500 P80404 500 100% 0 0
NP_065737.2 500 P80404 500 100% 0 0

Chromosomal Locations for CCDS 10534.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 8735740 8735809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8746001 8746098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8748108 8748137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8750422 8750539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8757757 8757806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8764069 8764149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8764738 8764830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8766208 8766270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8768193 8768256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8768825 8768973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8772780 8772917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8774890 8775057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8776344 8776490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8779479 8779590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 8781309 8781430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1503 nt):
ATGGCCTCCATGTTGCTCGCCCAGCGCCTGGCCTGCAGCTTCCAGCACAGCTACCGCCTGCTGGTGCCTG
GA
TCCAGACACATTAGTCAAGCTGCAGCCAAAGTCGACGTTGAATTTGATTATGATGGGCCTCTGATGAA
G
ACGGAAGTCCCAGGGCCTAGATCTCAGGAGTTAATGAAACAGCTGAATATAATTCAGAATGCAGAGGCT
GTG
CATTTTTTCTGCAATTACGAAGAGAGCCGAGGCAATTACCTGGTTGATGTGGACGGCAACCGAATGC
TG
GATCTTTATTCCCAGATCTCCTCTGTCCCCATAGGTTACAGCCACCCCGCCCTGCTGAAACTCATCCA
A
CAGCCTCAAAATGCGAGCATGTTTGTCAACAGACCCGCCCTCGGAATCCTGCCTCCGGAGAACTTTGTG
GAG
AAGCTCCGGCAGTCCTTGCTCTCGGTGGCTCCCAAAGGGATGTCCCAGCTCATCACCATGGCCTGCG
GC
TCCTGCTCCAATGAAAACGCCTTAAAGACCATCTTCATGTGGTACCGGAGCAAGGAAAGAGGGCAGAG
G
GGCTTCTCCCAGGAGGAGCTGGAGACGTGCATGATTAACCAGGCCCCTGGCTGCCCCGACTACAGCATC
CTC
TCCTTCATGGGCGCGTTCCATGGGAGGACCATGGGTTGCTTAGCGACCACGCACTCTAAAGCCATTC
AC
AAGATCGACATCCCTTCCTTTGACTGGCCCATCGCACCGTTCCCACGGCTGAAATACCCTCTGGAAGA
G
TTTGTGAAAGAGAACCAACAGGAGGAGGCCCGCTGTCTGGAAGAGGTGGAGGATCTGATTGTGAAATAT
CGG
AAAAAGAAGAAGACGGTGGCCGGGATCATCGTGGAGCCCATCCAGTCCGAGGGTGGAGACAACCACG
CA
TCCGATGACTTCTTTCGGAAGCTGAGAGACATCGCCAGGAAGCATGGCTGCGCCTTCTTGGTGGACGA
G
GTCCAGACCGGAGGAGGCTGCACGGGCAAGTTCTGGGCCCATGAGCACTGGGGCCTGGATGACCCAGCA
GAC
GTGATGACCTTCAGCAAGAAGATGATGACTGGGGGCTTCTTCCACAAGGAGGAGTTCAGGCCTAATG
CT
CCCTACCGGATCTTCAACACCTGGCTGGGGGACCCGTCCAAGAACCTGTTGCTGGCTGAGGTCATCAA
C
ATCATCAAGCGGGAGGACCTGCTAAATAATGCAGCCCATGCCGGGAAGGCCCTGCTCACAGGACTGCTG
GAC
CTCCAGGCCCGGTACCCCCAGTTCATCAGCAGGGTGAGAGGACGAGGCACCTTTTGCTCCTTCGATA
CT
CCCGATGATTCCATACGGAATAAGCTCATTTTAATTGCCAGAAACAAAGGTGTGGTGTTGGGTGGCTG
T
GGTGACAAATCCATTCGTTTCCGTCCCACGCTGGTCTTCAGGGATCACCACGCTCACCTGTTCCTCAAT
ATT
TTCAGTGACATCTTAGCAGACTTCAAGTAA


Translation (500 aa):
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEA
V
HFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPI
GYSHPALLKLIQQPQNASMFVNRPALGILPPENFV
E
KLRQSLLS
VAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSI
L
SFMGAFHGRTM
GCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKY
R
KKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARK
HGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA
D
VMTFSKKMMTGGFFHKEEFRPNA
PYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
D
LQ
ARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLN
I
FSDILADFK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser