NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS10403.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10403.1 Public Homo sapiens 16 RGS11 24 110 108 CCDS HistoryNCBI Gene:8786Re-query CCDS DB by CCDS ID:10403.1Re-query CCDS DB by GeneID:8786See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10403.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000316163.9 ENSP00000319069.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000316163.9Link to Ensembl Protein Viewer:ENSP00000319069.5Re-query CCDS DB by Nucleotide ID:ENST00000316163Re-query CCDS DB by Protein ID:ENSP00000319069
Original member Current member NCBI NM_003834.3 NP_003825.1 Accepted alive Link to Nucleotide Sequence:NM_003834.3Link to Protein Sequence:NP_003825.1Re-query CCDS DB by Nucleotide ID:NM_003834Re-query CCDS DB by Protein ID:NP_003825Link to BLAST:NP_003825.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003825.1 446 O94810-3 446 100% 0 0

Chromosomal Locations for CCDS 10403.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 269269 269383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 269503 269585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 270523 270661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 270744 270831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 270984 271099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 271202 271315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 271399 271460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 271540 271569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 272863 272931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 273475 273556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 273760 273836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 274043 274101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 274214 274265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 274976 275082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 275283 275333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 275402 275498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1341 nt):
ATGGAGCGGGTGGTCGTGAGCATGCAGGACCCCGACCAGGGCGTGAAGATGCGGAGCCAGCGCCTGCTGG
TC
ACCGTCATTCCCCACGCGGTGACAGGCAGCGACGTCGTGCAGTGGTTGGCCCAGAAGTTCTGCGTCTC
G
GAGGAGGAGGCCCTGCACCTGGGCGCCGTCCTGGTGCAGCATGGCTACATCTACCCGCTGCGCGACCCC
CGT
AGCCTCATGCTCCGGCCAGACGAGACGCCCTACAGGTTCCAGACCCCGTACTTCTGGACAAGTACCC
TG
AGGCCGGCTGCAGAGCTGGACTATGCCATCTACCTGGCCAAGAAGAACATCCGAAAACGGGGGACCCT
G
GTGGATTATGAGAAGGACTGCTATGACCGGCTACACAAGAAGATCAACCACGCATGGGACCTGGTGCTG
ATG
CAGGCGAGGGAGCAGCTGAGGGCAGCCAAGCAGCGCAGCAAGGGGGACAGGCTGGTCATTGCGTGCC
AG
GAGCAGACCTACTGGCTGGTGAACAGGCCCCCGCCCGGGGCCCCCGATGTGCTGGAGCAGGGTCCAGG
G
CGGGGATCCTGCGCTGCCAGCCGTGTGCTCATGACCAAGAGTGCAGATTTCCATAAGCGGGAGATCGAG
TAC
TTCAGGAAAGCGCTGGGCAGGACCCGAGTGAAGTCCTCCGTCTGCCTTGAGGCGTACCTGAGTTTCT
GC
GGCCAGCGTGGACCCCACGATCCCCTCGTGTCGGGGTGCCTGCCCAGCAATCCCTGGATCTCAGACAA
T
GACGCCTACTGGGTCATGAATGCCCCCACGGTGGCTGCCCCCACGAAGCTCCGTGTGGAGAGATGGGGC
TTC
AGCTTCCGGGAGCTCCTGGAGGACCCCGTGGGGCGGGCCCACTTCATGGACTTTCTGGGAAAGGAGT
TC
AGTGGAGAAAACCTCAGCTTCTGGGAGGCATGTGAGGAGCTTCGATATGGAGCGCAGGCCCAGGTCCC
C
ACCCTGGTGGATGCCGTGTACGAGCAGTTCCTGGCCCCCGGAGCTGCCCACTGGGTCAACATCGACAGC
CGG
ACCATGGAGCAGACCCTGGAGGGGCTGCGCCAGCCCCACCGCTATGTCCTGGATGACGCCCAGCTGC
AC
ATATACATGCTCATGAAGAAGGACTCCTACCCAAGGTTCCTGAAGTCTGACATGTACAAGGCCCTCCT
G
GCAGAGGCTGGGATCCCGCTGGAGATGAAGAGACGCGTGTTCCCGTTTACGTGGAGGCCACGGCACTCG
AGC
CCCAGCCCTGCACTCCTTCCCACCCCTGTGGAGCCCACAGCGGCTTGTGGCCCTGGGGGTGGAGATG
GG
GTGGCCTAG


Translation (446 aa):
MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDP
R
SLMLRPDETPYRFQ
TPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVL
M
QAREQL
RAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIE
Y
FRKALGRTRVKSSVCLE
AYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERWG
F
SFRELLEDPVGRAHFMDFLGKEFS
GENLSFWEACEELRYGAQAQVPTLVDAVYEQFLAPGAAHWVNIDS
R
TMEQTLEGLRQPHRYVLDDAQLHIYMLMKK
DSYPRFLKSDMYKALLAEAGIPLEMKRRVFPFTWRPRHS
S
PSPALLPTPVEPTAACGPGGGDGVA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser