NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS10365.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10365.1 Public Homo sapiens 15 FES 24 110 108 CCDS HistoryNCBI Gene:2242Re-query CCDS DB by CCDS ID:10365.1Re-query CCDS DB by GeneID:2242See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10365.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000328850.8 ENSP00000331504.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000328850.8Link to Ensembl Protein Viewer:ENSP00000331504.3Re-query CCDS DB by Nucleotide ID:ENST00000328850Re-query CCDS DB by Protein ID:ENSP00000331504
Original member Current member NCBI NM_002005.4 NP_001996.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_002005.4Link to Protein Sequence:NP_001996.1Re-query CCDS DB by Nucleotide ID:NM_002005Re-query CCDS DB by Protein ID:NP_001996Link to BLAST:NP_001996.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001996.1 822 P07332-1 822 100% 0 0

Chromosomal Locations for CCDS 10365.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 90885046 90885258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90885412 90885585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90886961 90887057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90887187 90887370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889306 90889443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889517 90889636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889840 90889962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890092 90890278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890401 90890484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890982 90891191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90891554 90891676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90892058 90892111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90892707 90892825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893100 90893194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893291 90893414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893654 90893811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893936 90894058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90895416 90895558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2469 nt):
ATGGGCTTCTCTTCCGAGCTGTGCAGCCCCCAGGGCCACGGGGTCCTGCAGCAAATGCAGGAGGCCGAGC
TT
CGTCTACTGGAGGGCATGAGAAAGTGGATGGCCCAGCGGGTCAAGAGTGACAGGGAGTATGCAGGACT
G
CTTCACCACATGTCCCTGCAGGACAGTGGGGGCCAGAGCCGGGCCATCAGCCCTGACAGCCCCATCAGT
CAG
TCCTGGGCTGAGATCACCAGCCAAACTGAGGGCCTGAGCCGCTTGCTGCGGCAGCACGCAGAGGATC
TG
AACTCAGGGCCCCTGAGCAAGCTGAGCCTGCTCATCCGGGAACGGCAGCAGCTTCGCAAGACCTACAG
C
GAGCAGTGGCAGCAGCTGCAGCAGGAGCTCACCAAGACCCACAGCCAGGACATTGAGAAGCTGAAGAGC
CAG
TACCGAGCTCTGGCACGGGACAGTGCCCAAGCCAAGCGCAAGTACCAGGAGGCCAGCAAAGACAAGG
AC
CGTGACAAGGCTAAGGACAAGTATGTGCGCAGCCTGTGGAAGCTCTTTGCTCACCACAACCGCTATGT
G
CTGGGCGTGCGGGCTGCGCAGCTACACCACCAGCACCACCACCAGCTCCTGCTGCCCGGCCTGCTGCGG
TCA
CTGCAGGACCTGCACGAGGAGATGGCTTGCATCCTGAAGGAGATCCTGCAGGAATACCTGGAGATTA
GC
AGCCTGGTGCAGGATGAGGTGGTGGCCATTCACCGGGAGATGGCTGCAGCTGCTGCCCGCATCCAGCC
T
GAGGCTGAGTACCAAGGCTTCCTGCGACAGTATGGGTCCGCACCTGACGTCCCACCCTGTGTCACGTTC
GAT
GAGTCACTGCTTGAGGAGGGTGAACCGCTGGAGCCTGGGGAGCTCCAGCTGAACGAGCTGACTGTGG
AG
AGCGTGCAGCACACGCTGACCTCAGTGACAGATGAGCTGGCTGTGGCCACCGAGATGGTGTTCAGGCG
G
CAGGAGATGGTTACGCAGCTGCAACAGGAGCTCCGGAATGAAGAGGAGAACACCCACCCCCGGGAGCGG
GTG
CAGCTGCTGGGCAAGAGGCAAGTGCTGCAAGAAGCACTGCAGGGGCTGCAGGTAGCGCTGTGCAGCC
AG
GCCAAGCTGCAGGCCCAGCAGGAGTTGCTGCAGACCAAGCTGGAGCACCTGGGCCCCGGCGAGCCCCC
G
CCTGTGCTGCTCCTGCAGGATGACCGCCACTCCACGTCGTCCTCGGAGCAGGAGCGAGAGGGGGGAAGG
ACA
CCCACGCTGGAGATCCTTAAGAGCCACATCTCAGGAATCTTCCGCCCCAAGTTCTCGCTCCCTCCAC
CG
CTGCAGCTCATTCCGGAGGTGCAGAAGCCCCTGCATGAGCAGCTGTGGTACCACGGGGCCATCCCGAG
G
GCAGAGGTGGCTGAGCTGCTGGTGCACTCTGGGGACTTCCTGGTGCGGGAGAGCCAGGGCAAGCAGGAG
TAC
GTGCTGTCGGTGCTGTGGGATGGTCTGCCCCGGCACTTCATCATCCAGTCCTTGGATAACCTGTACC
GA
CTGGAAGGGGAAGGCTTTCCTAGCATTCCTTTGCTCATCGACCACCTACTGAGCACCCAGCAGCCCCT
C
ACCAAGAAGAGTGGTGTTGTCCTGCACAGGGCTGTGCCCAAGGACAAGTGGGTGCTGAACCATGAGGAC
CTG
GTGTTGGGTGAGCAGATTGGACGGGGGAACTTTGGCGAAGTGTTCAGCGGACGCCTGCGAGCCGACA
AC
ACCCTGGTGGCGGTGAAGTCTTGTCGAGAGACGCTCCCACCTGACCTCAAGGCCAAGTTTCTACAGGA
A
GCGAGGATCCTGAAGCAGTACAGCCACCCCAACATCGTGCGTCTCATTGGTGTCTGCACCCAGAAGCAG
CCC
ATCTACATCGTCATGGAGCTTGTGCAGGGGGGCGACTTCCTGACCTTCCTCCGCACGGAGGGGGCCC
GC
CTGCGGGTGAAGACTCTGCTGCAGATGGTGGGGGATGCAGCTGCTGGCATGGAGTACCTGGAGAGCAA
G
TGCTGCATCCACCGGGACCTGGCTGCTCGGAACTGCCTGGTGACAGAGAAGAATGTCCTGAAGATCAGT
GAC
TTTGGGATGTCCCGAGAGGAAGCCGATGGGGTCTATGCAGCCTCAGGGGGCCTCAGACAAGTCCCCG
TG
AAGTGGACCGCACCTGAGGCCCTTAACTACGGCCGCTACTCCTCCGAAAGCGACGTGTGGAGCTTTGG
C
ATCTTGCTCTGGGAGACCTTCAGCCTGGGGGCCTCCCCCTATCCCAACCTCAGCAATCAGCAGACACGG
GAG
TTTGTGGAGAAGGGGGGCCGTCTGCCCTGCCCAGAGCTGTGTCCTGATGCCGTGTTCAGGCTCATGG
AG
CAGTGCTGGGCCTATGAGCCTGGGCAGCGGCCCAGCTTCAGCACCATCTACCAGGAGCTGCAGAGCAT
C
CGAAAGCGGCATCGGTGA


Translation (822 aa):
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPIS
Q
SWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKS
Q
YRALARDSAQAKRKYQEASK
DKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLR
S
LQDLHEEMACI
LKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTF
D
ESLLEEGEPLEPGELQLNELTVESVQH
TLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRER
V
QLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSS
EQEREGGR
T
PTLEILKSHISGIFRPKFS
LPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQE
Y
VLSVLWDGLPRHFIIQSLD
NLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHED
L
VLGEQIGR
GNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQ
P
IYIVMELVQ
GGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKIS
D
FGMSREEADGVYAASGGLRQVPVKWTAPEALNY
GRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTR
E
FVEK
GGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser