NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10350.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10350.1 Public Homo sapiens 15 POLG 22 109 92 CCDS HistoryNCBI Gene:5428Re-query CCDS DB by CCDS ID:10350.1Re-query CCDS DB by GeneID:5428See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10350.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000268124.9 ENSP00000268124.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268124.9Link to Ensembl Protein Viewer:ENSP00000268124.5Re-query CCDS DB by Nucleotide ID:ENST00000268124Re-query CCDS DB by Protein ID:ENSP00000268124
Original member Current member EBI ENST00000442287.6 ENSP00000399851.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000442287.6Link to Ensembl Protein Viewer:ENSP00000399851.2Re-query CCDS DB by Nucleotide ID:ENST00000442287Re-query CCDS DB by Protein ID:ENSP00000399851
Original member NCBI NM_001126131.1 NP_001119603.1 Updated not alive Link to Nucleotide Sequence:NM_001126131.1Link to Protein Sequence:NP_001119603.1Re-query CCDS DB by Nucleotide ID:NM_001126131Re-query CCDS DB by Protein ID:NP_001119603
Current member NCBI NM_001126131.2 NP_001119603.1 Accepted alive Link to Nucleotide Sequence:NM_001126131.2Link to Protein Sequence:NP_001119603.1Re-query CCDS DB by Nucleotide ID:NM_001126131Re-query CCDS DB by Protein ID:NP_001119603Link to BLAST:NP_001119603.1
Original member NCBI NM_002693.2 NP_002684.1 Updated not alive Link to Nucleotide Sequence:NM_002693.2Link to Protein Sequence:NP_002684.1Re-query CCDS DB by Nucleotide ID:NM_002693Re-query CCDS DB by Protein ID:NP_002684
Current member NCBI NM_002693.3 NP_002684.1 Accepted alive Link to Nucleotide Sequence:NM_002693.3Link to Protein Sequence:NP_002684.1Re-query CCDS DB by Nucleotide ID:NM_002693Re-query CCDS DB by Protein ID:NP_002684Link to BLAST:NP_002684.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001119603.1 1239 P54098 1239 100% 0 0
NP_002684.1 1239 P54098 1239 100% 0 0

Chromosomal Locations for CCDS 10350.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 89316751 89316827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89317376 89317536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89318541 89318749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89318931 89319099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89319228 89319350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89320766 89321012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89321125 89321260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89321736 89321853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89321962 89322015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89322742 89322902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89323404 89323511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89323815 89323901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89324107 89324227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89325450 89325686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89326612 89326738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89326912 89327063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89327167 89327349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89328456 89328535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89328685 89328831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89328943 89329110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89330081 89330276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89333096 89333754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3720 nt):
ATGAGCCGCCTGCTCTGGAGGAAGGTGGCCGGCGCCACCGTCGGGCCAGGGCCGGTTCCAGCTCCGGGGC
GC
TGGGTCTCCAGCTCCGTCCCCGCGTCCGACCCCAGCGACGGGCAGCGGCGGCGGCAGCAGCAGCAGCA
G
CAGCAGCAGCAGCAGCAACAGCAGCCTCAGCAGCCGCAAGTGCTATCCTCGGAGGGCGGGCAGCTGCGG
CAC
AACCCATTGGACATCCAGATGCTCTCGAGAGGGCTGCACGAGCAAATCTTCGGGCAAGGAGGGGAGA
TG
CCTGGCGAGGCCGCGGTGCGCCGCAGCGTCGAGCACCTGCAGAAGCACGGGCTCTGGGGGCAGCCAGC
C
GTGCCCTTGCCCGACGTGGAGCTGCGCCTGCCGCCCCTCTACGGGGACAACCTGGACCAGCACTTCCGC
CTC
CTGGCCCAGAAGCAGAGCCTGCCCTACCTGGAGGCGGCCAACTTGCTGTTGCAGGCCCAGCTGCCCC
CG
AAGCCCCCGGCTTGGGCCTGGGCGGAGGGCTGGACCCGGTACGGCCCCGAGGGGGAGGCCGTACCCGT
G
GCCATCCCCGAGGAGCGGGCCCTGGTGTTCGACGTGGAGGTCTGCTTGGCAGAGGGAACTTGCCCCACA
TTG
GCGGTGGCCATATCCCCCTCGGCCTGGTATTCCTGGTGCAGCCAGCGGCTGGTGGAAGAGCGTTACT
CT
TGGACCAGCCAGCTGTCGCCGGCTGACCTCATCCCCCTGGAGGTCCCTACTGGTGCCAGCAGCCCCAC
C
CAGAGAGACTGGCAGGAGCAGTTAGTGGTGGGGCACAATGTTTCCTTTGACCGAGCTCATATCAGGGAG
CAG
TACCTGATCCAGGGTTCCCGCATGCGTTTCCTGGACACCATGAGCATGCACATGGCCATCTCAGGGC
TA
AGCAGCTTCCAGCGCAGTCTGTGGATAGCAGCCAAGCAGGGCAAACACAAGGTCCAGCCCCCCACAAA
G
CAAGGCCAGAAGTCCCAGAGGAAAGCCAGAAGAGGCCCAGCGATCTCATCCTGGGACTGGCTGGACATC
AGC
AGTGTCAACAGTCTGGCAGAGGTGCACAGACTTTATGTAGGGGGGCCTCCCTTAGAGAAGGAGCCTC
GA
GAACTGTTTGTGAAGGGCACCATGAAGGACATTCGTGAGAACTTCCAGGACCTGATGCAGTACTGTGC
C
CAGGACGTGTGGGCCACCCATGAGGTTTTCCAGCAGCAGCTACCGCTCTTCTTGGAGAGGTGTCCCCAC
CCA
GTGACTCTGGCCGGCATGCTGGAGATGGGTGTCTCCTACCTGCCTGTCAACCAGAACTGGGAGCGTT
AC
CTGGCAGAGGCACAGGGCACTTATGAGGAGCTCCAGCGGGAGATGAAGAAGTCGTTGATGGATCTGGC
C
AATGATGCCTGCCAGCTGCTCTCAGGAGAGAGGTACAAAGAAGACCCCTGGCTCTGGGACCTGGAGTGG
GAC
CTGCAAGAATTTAAGCAGAAGAAAGCTAAGAAGGTGAAGAAGGAACCAGCCACAGCCAGCAAGTTGC
CC
ATCGAGGGGGCTGGGGCCCCTGGTGATCCCATGGATCAGGAAGACCTCGGCCCCTGCAGTGAGGAGGA
G
GAGTTTCAACAAGATGTCATGGCCCGCGCCTGCTTGCAGAAGCTGAAGGGGACCACAGAGCTCCTGCCC
AAG
CGGCCCCAGCACCTTCCTGGACACCCTGGATGGTACCGGAAGCTCTGCCCCCGGCTAGACGACCCTG
CA
TGGACCCCGGGCCCCAGCCTCCTCAGCCTGCAGATGCGGGTCACACCTAAACTCATGGCACTTACCTG
G
GATGGCTTCCCTCTGCACTACTCAGAGCGTCATGGCTGGGGCTACTTGGTGCCTGGGCGGCGGGACAAC
CTG
GCCAAGCTGCCGACAGGTACCACCCTGGAGTCAGCTGGGGTGGTCTGCCCCTACAGAGCCATCGAGT
CC
CTGTACAGGAAGCACTGTCTCGAACAGGGGAAGCAGCAGCTGATGCCCCAGGAGGCCGGCCTGGCGGA
G
GAGTTCCTGCTCACTGACAATAGTGCCATATGGCAAACGGTAGAAGAACTGGATTACTTAGAAGTGGAG
GCT
GAGGCCAAGATGGAGAACTTGCGAGCTGCAGTGCCAGGTCAACCCCTAGCTCTGACTGCCCGTGGTG
GC
CCCAAGGACACCCAGCCCAGCTATCACCATGGCAATGGACCTTACAACGACGTGGACATCCCTGGCTG
C
TGGTTTTTCAAGCTGCCTCACAAGGATGGTAATAGCTGTAATGTGGGAAGCCCCTTTGCCAAGGACTTC
CTG
CCCAAGATGGAGGATGGCACCCTGCAGGCTGGCCCAGGAGGTGCCAGTGGGCCCCGTGCTCTGGAAA
TC
AACAAAATGATTTCTTTCTGGAGGAACGCCCATAAACGTATCAGCTCCCAGATGGTGGTGTGGCTGCC
C
AGGTCAGCTCTGCCCCGTGCTGTGATCAGGCACCCCGACTATGATGAGGAAGGCCTCTATGGGGCCATC
CTG
CCCCAAGTGGTGACTGCCGGCACCATCACTCGCCGGGCTGTGGAGCCCACATGGCTCACCGCCAGCA
AT
GCCCGGCCTGACCGAGTAGGCAGTGAGTTGAAAGCCATGGTGCAGGCCCCACCTGGCTACACCCTTGT
G
GGTGCTGATGTGGACTCCCAAGAGCTGTGGATTGCAGCTGTGCTTGGAGACGCCCACTTTGCCGGCATG
CAT
GGCTGCACAGCCTTTGGGTGGATGACACTGCAGGGCAGGAAGAGCAGGGGCACTGATCTACACAGTA
AG
ACAGCCACTACTGTGGGCATCAGCCGTGAGCATGCCAAAATCTTCAACTACGGCCGCATCTATGGTGC
T
GGGCAGCCCTTTGCTGAGCGCTTACTAATGCAGTTTAACCACCGGCTCACACAGCAGGAGGCAGCTGAG
AAG
GCCCAGCAGATGTACGCTGCCACCAAGGGCCTCCGCTGGTATCGGCTGTCGGATGAGGGCGAGTGGC
TG
GTGAGGGAGTTGAACCTCCCAGTGGACAGGACTGAGGGTGGCTGGATTTCCCTGCAGGATCTGCGCAA
G
GTCCAGAGAGAAACTGCAAGGAAGTCACAGTGGAAGAAGTGGGAGGTGGTTGCTGAACGGGCATGGAAG
GGG
GGCACAGAGTCAGAAATGTTCAATAAGCTTGAGAGCATTGCTACGTCTGACATACCACGTACCCCGG
TG
CTGGGCTGCTGCATCAGCCGAGCCCTGGAGCCCTCGGCTGTCCAGGAAGAGTTTATGACCAGCCGTGT
G
AATTGGGTGGTACAGAGCTCTGCTGTTGACTACTTACACCTCATGCTTGTGGCCATGAAGTGGCTGTTT
GAA
GAGTTTGCCATAGATGGGCGCTTCTGCATCAGCATCCATGACGAGGTTCGCTACCTGGTGCGGGAGG
AG
GACCGCTACCGCGCTGCCCTGGCCTTGCAGATCACCAACCTCTTGACCAGGTGCATGTTTGCCTACAA
G
CTGGGTCTGAATGACTTGCCCCAGTCAGTCGCCTTTTTCAGTGCAGTCGATATTGACCGGTGCCTCAGG
AAG
GAAGTGACCATGGATTGTAAAACCCCTTCCAACCCAACTGGGATGGAAAGGAGATACGGGATTCCCC
AG
GGTGAAGCGCTGGATATTTACCAGATAATTGAACTCACCAAAGGCTCCTTGGAAAAACGAAGCCAGCC
T
GGACCATAG


Translation (1239 aa):
MSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLR
H
NPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFR
L
LAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPT
L
AVAISPSA
WYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIRE
Q
YLIQ
GSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDI
S
SVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQ
DLMQYCAQDVWATHEVFQQQLPLFLERCPH
P
VTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGE
RYKEDPWLWDLEW
D
LQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQE
DLGPCSEEEEFQQDVMARACLQKLKGTTELLP
K
RPQHLPGHP
GWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDN
L
AKLPTGTTLESAGVVCPY
RAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVE
A
EAKMENLRAAVPGQPLAL
TARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDF
L
PKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRI
SSQMVVWLPRSALPRAVIRHPDYDEEGLYGAI
L
PQVVTAGTITRRAVEPTWLTASNAR
PDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGM
H
GCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAE
K
AQQMYAATKGLR
WYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWK
G
GTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEE
FMTSRVNWVVQSSAVDYLHLMLVAMKWLF
E
EFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLT
RCMFAYKLGLNDLPQSVAFFSAVDIDRCLR
K
EVTMDCKTPSNPTGMERRYGIPQ
GEALDIYQIIELTKGSLEKRSQPGP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser