NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10084.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10084.1 Public Homo sapiens 15 GANC 22 109 92 CCDS HistoryNCBI Gene:2595Re-query CCDS DB by CCDS ID:10084.1Re-query CCDS DB by GeneID:2595See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10084.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000318010.12 ENSP00000326227.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000318010.12Link to Ensembl Protein Viewer:ENSP00000326227.8Re-query CCDS DB by Nucleotide ID:ENST00000318010Re-query CCDS DB by Protein ID:ENSP00000326227
Original member NCBI NM_198141.2 NP_937784.2 Updated not alive Link to Nucleotide Sequence:NM_198141.2Link to Protein Sequence:NP_937784.2Re-query CCDS DB by Nucleotide ID:NM_198141Re-query CCDS DB by Protein ID:NP_937784
Current member NCBI NM_198141.3 NP_937784.2 Accepted alive Link to Nucleotide Sequence:NM_198141.3Link to Protein Sequence:NP_937784.2Re-query CCDS DB by Nucleotide ID:NM_198141Re-query CCDS DB by Protein ID:NP_937784Link to BLAST:NP_937784.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_937784.2 914 Q8TET4 914 100% 0 0

Chromosomal Locations for CCDS 10084.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 42274482 42274510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42276348 42276410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42278482 42278590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42287691 42287818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42292735 42292917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42297611 42297656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42306546 42306612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42308222 42308318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42310283 42310463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42310693 42310846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42321785 42322020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42326298 42326424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42327363 42327442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42329306 42329449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42330576 42330672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42338389 42338490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42339669 42339912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42340690 42340754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42343078 42343154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42345758 42345832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42348103 42348216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42349383 42349495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42351329 42351432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42352030 42352139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2745 nt):
ATGGAAGCAGCAGTGAAAGAGGAAATAAGTCTTGAAGATGAAGCTGTAGATAAAAACATTTTCAGAGACT
GT
AACAAGATCGCATTTTACAGGCGTCAGAAACAGTGGCTTTCCAAGAAGTCCACCTATCAGGCATTATT
G
GATTCAGTCACAACAGATGAAGACAGCACCAGGTTCCAAATCATCAATGAAGCAAGTAAGGTTCCTCTC
CTG
GCTGAAATTTATGGTATAGAAGGAAACATTTTCAGGCTTAAAATTAATGAAGAGACTCCTCTAAAAC
CC
AGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTAAGGCTGATTTCATGCTCTGGGGA
C
ACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTCAAG
GTA
GACTTGGTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATC
TA
CAGATTCTTCACAAACAAAGAGCTGCTAAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGA
A
AATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTTGGAAAATTTGTGGATATCAAAGCTAATGGCCCT
TCT
TCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCACAACATGCAGAAT
CA
CACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCA
A
ATATATGATAAAATGGGCATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATA
GGT
ATTTTCTGGCTGAATGCCTCGGAAACACTGGTGGAGATCAATACAGAGCCTGCAGTAGAGTACACAC
TG
ACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGCACTCATGTGCACTGGATGTCAGA
G
AGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACACCTTCTGATGTCTTCAAACAGTACTCACAC
CTT
ACAGGCACACAAGCCATGCCCCCTCTTTTCTCTTTGGGATACCACCAGTGCCGCTGGAACTATGAAG
AT
GAGCAGGATGTAAAAGCAGTGGATGCAGGGTTTGATGAGCATGACATTCCTTATGATGCCATGTGGCT
G
GACATAGAGCACACTGAGGGCAAGAGGTACTTCACCTGGGACAAAAACAGATTCCCAAACCCCAAGAGG
ATG
CAAGAGCTGCTCAGGAGCAAAAAGCGTAAGCTTGTGGTCATCAGTGATCCCCACATCAAGATTGATC
CT
GACTACTCAGTATATGTGAAGGCCAAAGATCAGGGCTTCTTTGTGAAGAATCAGGAAGGGGAAGACTT
T
GAAGGGGTGTGTTGGCCAGGTCTCTCCTCTTACCTGGATTTCACCAATCCCAAGGTCAGAGAGTGGTAT
TCA
AGTCTTTTTGCTTTCCCTGTTTATCAGGGATCTACGGACATCCTCTTCCTTTGGAATGACATGAATG
AG
CCTTCTGTCTTTAGAGGGCCAGAGCAAACCATGCAGAAGAATGCCATTCATCATGGCAATTGGGAGCA
C
AGAGAGCTCCACAACATCTACGGTTTTTATCATCAAATGGCTACTGCAGAAGGACTGATAAAACGATCT
AAA
GGGAAGGAGAGACCCTTTGTTCTTACACGTTCTTTCTTTGCTGGATCACAAAAGTATGGTGCCGTGT
GG
ACAGGCGACAACACAGCAGAATGGAGCAACTTGAAAATTTCTATCCCAATGTTACTCACTCTCAGCAT
T
ACTGGGATCTCTTTTTGCGGAGCTGACATAGGCGGGTTCATTGGGAATCCAGAGACAGAGCTGCTAGTG
CGT
TGGTACCAGGCTGGAGCCTACCAGCCCTTCTTCCGTGGCCATGCCACCATGAACACCAAGCGACGAG
AG
CCCTGGCTCTTTGGGGAGGAACACACCCGACTCATCCGAGAAGCCATCAGAGAGCGCTATGGCCTCCT
G
CCATATTGGTATTCTCTGTTCTACCATGCACACGTGGCTTCCCAACCTGTCATGAGGCCTCTGTGGGTA
GAG
TTCCCTGATGAACTAAAGACTTTTGATATGGAAGATGAATACATGCTGGGGAGTGCATTATTGGTTC
AT
CCAGTCACAGAACCAAAAGCCACCACAGTTGATGTGTTTCTTCCAGGATCAAATGAGGTCTGGTATGA
C
TATAAGACATTTGCTCATTGGGAAGGAGGGTGTACTGTAAAGATCCCAGTAGCCTTGGACACTATTCCA
GTG
TTTCAGCGAGGTGGAAGTGTGATACCAATAAAGACAACTGTAGGAAAATCCACAGGCTGGATGACTG
AA
TCCTCCTATGGACTCCGGGTTGCTCTAAGCACTAAGGGTTCTTCAGTGGGTGAGTTATATCTTGATGA
T
GGCCATTCATTCCAATACCTCCACCAGAAGCAATTTTTGCACAGGAAGTTTTCATTCTGTTCCAGTGTT
CTG
ATCAATAGTTTTGCTGACCAGAGGGGTCATTATCCCAGCAAGTGTGTGGTGGAGAAGATCTTGGTCT
TA
GGCTTCAGGAAGGAGCCATCTTCTGTGACTACCCACTCATCTGATGGTAAAGATCAGCCTGTGGCTTT
T
ACGTATTGTGCCAAAACATCCATCCTGAGCCTGGAGAAGCTCTCACTCAACATTGCCACTGACTGGGAG
GTC
CGCATCATATGA


Translation (914 aa):
MEAAVKEEISLEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQIINEASKVPL
L
AEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTV
RLISCSGDTGSLILADGKGDLKCHITANPFK
V
DLVSEEEVVISINSLGQLYFEHLQILHKQ
RAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP
S
SIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTI
G
IFWLNASETLVEINTEPAVE
YTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSH
L
T
GTQAMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKR
M
QELLRSKKRK
LVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLDFTNPKVREWY
S
SLFAFPVYQ
GSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHRELHNIYGFYHQMATAEGLIKRS
K
GKERPFVLTRSFFAGSQKY
GAVWTGDNTAEWSNLKISIPMLLTLSITGISFCGADIGGFIGNPETELLV
R
WYQAGAYQPFFRGHATMNTKRREPWLFGEEHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVM
RPLWV
E
FPDELKTFDMEDEYML
GSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIP
V
FQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTK
GSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
L
IN
SFADQRGHYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWE
V
RII




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser