NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18581.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18581.1 Public Mus musculus 4 Ppcs 21 106 86 CCDS HistoryNCBI Gene:106564Re-query CCDS DB by CCDS ID:18581.1Re-query CCDS DB by GeneID:106564See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18581.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030385 ENSMUSP00000030385 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030385Link to Ensembl Protein Viewer:ENSMUSP00000030385Re-query CCDS DB by Nucleotide ID:ENSMUST00000030385Re-query CCDS DB by Protein ID:ENSMUSP00000030385
Original member Current member EBI,WTSI OTTMUST00000021465 OTTMUSP00000009810 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000021465Link to Vega Protein Viewer:OTTMUSP00000009810Re-query CCDS DB by Nucleotide ID:OTTMUST00000021465Re-query CCDS DB by Protein ID:OTTMUSP00000009810
Original member NCBI NM_026494.3 NP_080770.2 Updated not alive Link to Nucleotide Sequence:NM_026494.3Link to Protein Sequence:NP_080770.2Re-query CCDS DB by Nucleotide ID:NM_026494Re-query CCDS DB by Protein ID:NP_080770
Current member NCBI NM_026494.4 NP_080770.2 Accepted alive Link to Nucleotide Sequence:NM_026494.4Link to Protein Sequence:NP_080770.2Re-query CCDS DB by Nucleotide ID:NM_026494Re-query CCDS DB by Protein ID:NP_080770Link to BLAST:NP_080770.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080770.2 311 Q8VDG5-1 311 100% 0 0

Chromosomal Locations for CCDS 18581.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 119418970 119419293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 119421580 119421683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 119421846 119422353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGGCGGAAATGGACCTGGTGGCTGAGTTGCCGCGTCCTGCGGGTGCTGCGCGCTGGGCCGAGGTTATGG
CT
CGCTTTGCGGCCAGGCTGGGCGAGCAGGGCCGGCGGGTGGTGCTGATCACATCTGGAGGCACCAAGGT
C
CCCCTGGAAGCGCGAGCCGTGCGCTTTCTGGACAACTTCAGTAGCGGGCGACGCGGAGCCGCGTCGGCG
GAG
GTCTTCCTGGCTGCCGGCTATGGAGTCCTGTTCTTGTACCGAGCGCGCTCGGCCTTCCCCTATGCCC
AC
CGCTTCCCGCCCCAGGCCTGGCTGTCAGCCCTTCGGCCTTCTGGCCCAGCCCAGTCGGGCAAGCTGAG
T
CTGGAGGCCGAAGAGAATGCGCTCCCGGGCTTTGCTGCAGCATTGCAGAGCTACCAAGAGGCAGCCGCT
GCC
GGCACCTTTCTGGCTGTAGAGTTTACCACTTTGGCGGATTATCTGCATCTGCTGCAGGCTGCTGCCC
TG
GCTCTCAGTCCATTAGGCTCTTCTGCGATGTTTTACCTGGCCGCGGCAGTGTCAGATTTCTATATTCC
T
GTCTCCGAAATGCCTGAACACAAGATCCACTCATCTGGTGGCCCACTGCAGATAACAATGAAGATGGTG
CCA
AAGATGCTTTCCCCTCTGGTCAAAGACTGGGCTCCTAAAGCGTTTGTAGTTTCCTTTAAGCTGGAGA
CA
GACCCGGACATCATAATCAGTCGGGCTCGGAATGCTTTGGAAGTTTACCAGCATCAGGTGGTGGTGGC
C
AACATCCTGGAGTCAATAAAGTCCTTTGTGATTATTGTAACCAAAGACTCGGAGACAGAGTTACTGCTG
TCC
GAGGAGGAGGTGGCAAAAGGCTTGGTGATAGAAGAGAAGATAGTAGATGACCTTCGGTCTCGACACA
CA
GCTTTTATATGTGACAAAAACTGA


Translation (311 aa):
MAEMDLVAELPRPAGAARWAEVMARFAARLGEQGRRVVLITSGGTKVPLEARAVRFLDNFSSGRRGAASA
E
VFLAAGYGVLFLYRARSAFPYAHRFPPQAWLSALRPSGPAQSGKLSLEAEENALPGFAAALQSYQEAAA
A
GTFLAVEFTTLADYLHLLQAAALALSPL
GSSAMFYLAAAVSDFYIPVSEMPEHKIHSSGGPLQITMKMV
P
KMLSPLVKDWAPKAFVVSFKLETDPDIIISRARNALEVYQHQVVVANILESIKSFVIIVTKDSETELLL
S
EEEVAKGLVIEEKIVDDLRSRHTAFICDKN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser