NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8010.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8010.1 Public Homo sapiens 11 FEN1 22 109 92 CCDS HistoryNCBI Gene:2237Re-query CCDS DB by CCDS ID:8010.1Re-query CCDS DB by GeneID:2237See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8010.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000305885.2 ENSP00000305480.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000305885.2Link to Ensembl Protein Viewer:ENSP00000305480.2Re-query CCDS DB by Nucleotide ID:ENST00000305885Re-query CCDS DB by Protein ID:ENSP00000305480
Original member NCBI NM_004111.5 NP_004102.1 Updated not alive Link to Nucleotide Sequence:NM_004111.5Link to Protein Sequence:NP_004102.1Re-query CCDS DB by Nucleotide ID:NM_004111Re-query CCDS DB by Protein ID:NP_004102
Current member NCBI NM_004111.6 NP_004102.1 Accepted alive Link to Nucleotide Sequence:NM_004111.6Link to Protein Sequence:NP_004102.1Re-query CCDS DB by Nucleotide ID:NM_004111Re-query CCDS DB by Protein ID:NP_004102Link to BLAST:NP_004102.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004102.1 380 P39748-1 380 100% 0 0

Chromosomal Locations for CCDS 8010.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 61795362 61796504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1143 nt):
ATGGGAATTCAAGGCCTGGCCAAACTAATTGCTGATGTGGCCCCCAGTGCCATCCGGGAGAATGACATCA
AG
AGCTACTTTGGCCGTAAGGTGGCCATTGATGCCTCTATGAGCATTTATCAGTTCCTGATTGCTGTTCG
C
CAGGGTGGGGATGTGCTGCAGAATGAGGAGGGTGAGACCACCAGCCACCTGATGGGCATGTTCTACCGC
ACC
ATTCGCATGATGGAGAACGGCATCAAGCCCGTGTATGTCTTTGATGGCAAGCCGCCACAGCTCAAGT
CA
GGCGAGCTGGCCAAACGCAGTGAGCGGCGGGCTGAGGCAGAGAAGCAGCTGCAGCAGGCTCAGGCTGC
T
GGGGCCGAGCAGGAGGTGGAAAAATTCACTAAGCGGCTGGTGAAGGTCACTAAGCAGCACAATGATGAG
TGC
AAACATCTGCTGAGCCTCATGGGCATCCCTTATCTTGATGCACCCAGTGAGGCAGAGGCCAGCTGTG
CT
GCCCTGGTGAAGGCTGGCAAAGTCTATGCTGCGGCTACCGAGGACATGGACTGCCTCACCTTCGGCAG
C
CCTGTGCTAATGCGACACCTGACTGCCAGTGAAGCCAAAAAGCTGCCAATCCAGGAATTCCACCTGAGC
CGG
ATTCTGCAGGAGCTGGGCCTGAACCAGGAACAGTTTGTGGATCTGTGCATCCTGCTAGGCAGTGACT
AC
TGTGAGAGTATCCGGGGTATTGGGCCCAAGCGGGCTGTGGACCTCATCCAGAAGCACAAGAGCATCGA
G
GAGATCGTGCGGCGACTTGACCCCAACAAGTACCCTGTGCCAGAAAATTGGCTCCACAAGGAGGCTCAC
CAG
CTCTTCTTGGAACCTGAGGTGCTGGACCCAGAGTCTGTGGAGCTGAAGTGGAGCGAGCCAAATGAAG
AA
GAGCTGATCAAGTTCATGTGTGGTGAAAAGCAGTTCTCTGAGGAGCGAATCCGCAGTGGGGTCAAGAG
G
CTGAGTAAGAGCCGCCAAGGCAGCACCCAGGGCCGCCTGGATGATTTCTTCAAGGTGACCGGCTCACTC
TCT
TCAGCTAAGCGCAAGGAGCCAGAACCCAAGGGATCCACTAAGAAGAAGGCAAAGACTGGGGCAGCAG
GG
AAGTTTAAAAGGGGAAAATAA


Translation (380 aa):
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYR
T
IRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDE
C
KHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLS
R
ILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAH
Q
LFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL
S
SAKRKEPEPKGSTKKKAKTGAAGKFKRGK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser