NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7185.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7185.1 Public Homo sapiens 10 CREM 22 109 92 CCDS HistoryNCBI Gene:1390Re-query CCDS DB by CCDS ID:7185.1Re-query CCDS DB by GeneID:1390See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7185.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000361599.8 ENSP00000354593.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361599.8Link to Ensembl Protein Viewer:ENSP00000354593.4Re-query CCDS DB by Nucleotide ID:ENST00000361599Re-query CCDS DB by Protein ID:ENSP00000354593
Original member NCBI NM_182771.1 NP_877572.1 Updated not alive Link to Nucleotide Sequence:NM_182771.1Link to Protein Sequence:NP_877572.1Re-query CCDS DB by Nucleotide ID:NM_182771Re-query CCDS DB by Protein ID:NP_877572
Current member NCBI NM_182771.2 NP_877572.1 Accepted alive Link to Nucleotide Sequence:NM_182771.2Link to Protein Sequence:NP_877572.1Re-query CCDS DB by Nucleotide ID:NM_182771Re-query CCDS DB by Protein ID:NP_877572Link to BLAST:NP_877572.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_877572.1 270 Q03060-12 270 100% 0 0

Chromosomal Locations for CCDS 7185.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 35167726 35167803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 35178889 35178986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 35179134 35179276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 35188200 35188388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 35206895 35207051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 35211656 35211803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (813 nt):
ATGTGGTGGCATCAGCATAATCTATGTTTCAGGCGTCCTATAGAAGAGGATTATTCTTCAGGGGATGTGG
AA
GAAAAGGTAGCAGCAATTGCAGAGACAGATGAATCTGCAGAATCAGAAGGTGTAATTGATTCTCATAA
A
CGTAGAGAAATCCTTTCACGAAGACCCTCTTATAGGAAAATACTGAATGAACTGTCCTCTGATGTGCCT
GGT
GTTCCCAAGATTGAAGAAGAGAGATCAGAGGAAGAAGGAACACCACCTAGTATTGCTACCATGGCAG
TA
CCAACTAGCATATATCAGACTAGCACGGGGCAATACATTGCTATAGCCCAAGGTGGAACAATCCAGAT
T
TCTAACCCAGGATCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCAGGAGCTCCTCCA
CCA
GGTGCTACAATTGTACAGTACGCAGCACAATCAGCTGATGGCACACAGCAGTTCTTTGTCCCAGGCA
GC
CAGGTTGTTGTTCAAGCTGCCACTGGTGACATGCCAACTTACCAGATCCGAGCTCCTACTGCTGCTTT
G
CCACAGGGAGTGGTGATGGCTGCATCGCCCGGAAGTTTGCACAGTCCCCAGCAGCTGGCAGAAGAAGCA
ACA
CGCAAACGAGAGCTGAGGCTAATGAAAAACAGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAG
AA
TATGTAAAATGTCTGGAGAGCCGAGTTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACT
T
GAAACCTTGAAAGACATTTGTTCTCCCAAAACAGATTACTAG


Translation (270 aa):
MWWHQHNLCFRRPIEEDYSSGDVEEKVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVP
G
VPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQY
IAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPP
P
GATIVQYAAQSADGTQQFFVPGSQVVVQ
AATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEA
T
RKRELRLMKN
REAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser