NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52062.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52062.1 Public Mus musculus 7 Tomm40 23 108 98 CCDS HistoryNCBI Gene:53333Re-query CCDS DB by CCDS ID:52062.1Re-query CCDS DB by GeneID:53333See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52062.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032555.9 ENSMUSP00000032555.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032555.9Link to Ensembl Protein Viewer:ENSMUSP00000032555.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000032555Re-query CCDS DB by Protein ID:ENSMUSP00000032555
Original member Current member EBI,WTSI ENSMUST00000093552.11 ENSMUSP00000104090.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000093552.11Link to Ensembl Protein Viewer:ENSMUSP00000104090.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000093552Re-query CCDS DB by Protein ID:ENSMUSP00000104090
Original member Current member NCBI NM_001109748.1 NP_001103218.1 Accepted alive Link to Nucleotide Sequence:NM_001109748.1Link to Protein Sequence:NP_001103218.1Re-query CCDS DB by Nucleotide ID:NM_001109748Re-query CCDS DB by Protein ID:NP_001103218Link to BLAST:NP_001103218.1
Original member Current member NCBI NM_016871.2 NP_058567.2 Accepted alive Link to Nucleotide Sequence:NM_016871.2Link to Protein Sequence:NP_058567.2Re-query CCDS DB by Nucleotide ID:NM_016871Re-query CCDS DB by Protein ID:NP_058567Link to BLAST:NP_058567.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103218.1 361 Q9QYA2 361 100% 0 0
NP_058567.2 361 Q9QYA2 361 100% 0 0

Chromosomal Locations for CCDS 52062.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 19701718 19701857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19702848 19702950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19703066 19703142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19703269 19703391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19710733 19710838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19710918 19711019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19713669 19713761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19714293 19714360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19714981 19715254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGGGGAACGTGTTGGCTGCCAGCTCTCCGCCCGCAGGGCCACCGCCGCCTCCTACGCCGTCCCTCGTGG
GG
CTCCCGCCGCCGCCTCCTTCGCCGCCAGGCTTCACTCTGCCGCCGCTCGGCGGCGGCCTGGGCACTGG
G
TCAAGCACTGGCCGTGGTTCGGAACGGACTCCCGGGGCTGCGGCCAGCGGCGCTGCGGCGGCCTCGGAA
GAT
GGGAGCTGCGGATGCCTGCCCAACCCGGGGACGTTCGAGGAGTGCCACCGGAAGTGCAAGGAGCTGT
TT
CCAGTTCAGATGGAAGGTGTCAAACTTACAGTCAACAAAGGGTTGAGCAACCGTTTCCAGGTGACCCA
C
ACAGTAGCCCTCGGCACAATTGGGGAGTCCAACTACCACTTTGGGGTCACATACGTGGGGACGAAGCAG
CTG
AGTCCCACAGAGGCGTTCCCCGTGCTGGTGGGTGACATGGACAATAGTGGCAGCCTCAATGCACAGG
TC
ATCCACCAGCTGAGCCCAGGCCTCAGGTCCAAAATGGCCATCCAGACCCAGCAGTCCAAGTTCGTGAA
C
TGGCAGGTGGATGGCGAGTACCGTGGTTCTGACTTCACAGCTGCTGTCACCCTGGGCAACCCAGATGTC
TTG
GTGGGTTCAGGAATCCTCGTGGCCCACTACCTCCAGAGCATCACACCGTGTCTGGCCCTGGGTGGAG
AG
CTCGTCTACCACCGGCGGCCAGGAGAGGAGGGCACTGTCATGTCTCTAGCTGGGAAATACACACTGAA
C
AACTGGTTGGCTACAGTAACGCTGGGCCAGGCAGGCATGCATGCGACGTATTACCACAAAGCCAGTGAC
CAG
CTGCAGGTGGGTGTGGAGTTTGAGGCCAGCACCAGGATGCAGGACACCAGTGCCTCCTTTGGGTATC
AG
CTGGACCTGCCCAAGGCCAACTTCCTTTTTAAAGGCTCTGTGAACAGTAACTGGATCGTGGGCGCCAC
G
CTGGAGAAGAAGCTTCCGCCCTTGCCCCTGACACTGTCCCTCTGCGCCTTCCTGAACCACCGCAAGAAT
AAG
TTCCTGTGTGGCTTCGGCCTCACCATCGGCTGA


Translation (361 aa):
MGNVLAASSPPAGPPPPPTPSLVGLPPPPPSPPGFTLPPLGGGLGTGSSTGRGSERTPGAAASGAAAASE
D
GSCGCLPNPGTFEECHRKCK
ELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYVGTKQ
L
SPTE
AFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDV
L
VGS
GILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASD
Q
LQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSNWIVGATLEKKLPPLPLTLSLCAFLNHRKN
K
FLCGFGLTIG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser