NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, January 22, 2020, starting at 8:00 a.m. EST for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS47933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47933.1 Public Homo sapiens 8 PUF60 22 109 92 CCDS HistoryNCBI Gene:22827Re-query CCDS DB by CCDS ID:47933.1Re-query CCDS DB by GeneID:22827See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000349157.10 ENSP00000322036.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000349157.10Link to Ensembl Protein Viewer:ENSP00000322036.7Re-query CCDS DB by Nucleotide ID:ENST00000349157Re-query CCDS DB by Protein ID:ENSP00000322036
Original member NCBI NM_014281.4 NP_055096.2 Updated not alive Link to Nucleotide Sequence:NM_014281.4Link to Protein Sequence:NP_055096.2Re-query CCDS DB by Nucleotide ID:NM_014281Re-query CCDS DB by Protein ID:NP_055096
Current member NCBI NM_014281.5 NP_055096.2 Accepted alive Link to Nucleotide Sequence:NM_014281.5Link to Protein Sequence:NP_055096.2Re-query CCDS DB by Nucleotide ID:NM_014281Re-query CCDS DB by Protein ID:NP_055096Link to BLAST:NP_055096.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055096.2 542 Q9UHX1-2 542 100% 0 0

Chromosomal Locations for CCDS 47933.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 143816520 143816819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143816910 143817145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143817331 143817466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143817592 143817782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143817862 143818075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143818193 143818285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143818373 143818534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143821597 143821686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143821818 143821913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143824313 143824399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 143829280 143829303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1629 nt):
ATGGCGACGGCGACCATAGCTCTCCAGGTCAATGGCCAGCAAGGAGGGGGGTCCGAGCCGGCGGCGGCGG
CG
GCAGTGGTGGCAGCGGGAGACAAATGGAAACCTCCACAGGGCACAGACTCCATCAAGATGGAGAACGG
G
CAGAGCACAGCCGCCAAGCTGGGGCTGCCTCCCCTGACGCCCGAGCAGCAGGAGGCCCTTCAGAAGGCC
AAG
AAGTACGCCATGGAGCAGAGCATCAAGAGTGTGCTGGTGAAGCAGACCATCGCGCACCAGCAGCAGC
AG
CTCACCAACCTGCAGATGGCGGCTCAGCGGCAGCGGGCGCTGGCCATCATGTGCCGCGTCTACGTGGG
C
TCTATCTACTATGAGCTGGGGGAGGACACCATCCGCCAGGCCTTTGCCCCCTTTGGCCCCATCAAGAGC
ATC
GACATGTCCTGGGACTCCGTCACCATGAAGCACAAGGGCTTTGCCTTCGTGGAGTATGAGGTCCCCG
AA
GCTGCACAGCTGGCCTTGGAGCAGATGAACTCGGTGATGCTGGGGGGCAGGAACATCAAGGTGGGCAG
A
CCCAGCAACATAGGGCAGGCCCAGCCCATCATAGACCAGTTGGCTGAGGAGGCACGGGCCTTCAACCGC
ATC
TACGTGGCCTCTGTGCACCAGGACCTCTCAGACGATGACATCAAGAGCGTGTTTGAGGCCTTTGGCA
AG
ATCAAGTCCTGCACACTGGCCCGGGACCCCACAACTGGCAAGCACAAGGGCTACGGCTTCATTGAGTA
C
GAGAAGGCCCAGTCGTCCCAAGATGCTGTGTCTTCCATGAACCTCTTTGACCTGGGTGGCCAGTACTTG
CGG
GTGGGCAAGGCTGTCACACCGCCCATGCCCCTACTCACACCAGCCACGCCTGGAGGCCTCCCACCTG
CC
GCTGCTGTGGCAGCTGCTGCAGCCACTGCCAAGATCACAGCTCAGGAAGCAGTGGCCGGAGCAGCGGT
G
CTGGGTACCCTGGGCACACCTGGACTGGTGTCCCCAGCACTGACCCTGGCCCAGCCCCTGGGCACTTTG
CCC
CAGGCTGTCATGGCTGCCCAGGCACCTGGAGTCATCACAGGTGTGACCCCAGCCCGTCCTCCTATCC
CG
GTCACCATCCCCTCGGTGGGAGTGGTGAACCCCATCCTGGCCAGCCCTCCAACGCTGGGTCTCCTGGA
G
CCCAAGAAGGAGAAGGAAGAAGAGGAGCTGTTTCCCGAGTCAGAGCGGCCAGAGATGCTGAGCGAGCAG
GAG
CACATGAGCATCTCGGGCAGTAGCGCCCGACACATGGTGATGCAGAAGCTGCTCCGCAAGCAGGAGT
CT
ACAGTGATGGTTCTGCGCAACATGGTGGACCCCAAGGACATCGATGATGACCTGGAAGGGGAGGTGAC
A
GAGGAGTGTGGCAAGTTCGGGGCCGTGAACCGCGTCATCATCTACCAAGAGAAACAAGGCGAGGAGGAG
GAT
GCAGAAATCATTGTCAAGATCTTTGTGGAGTTTTCCATAGCCTCTGAGACTCATAAGGCCATCCAGG
CC
CTCAATGGCCGCTGGTTTGCTGGCCGCAAGGTGGTGGCTGAAGTGTACGACCAGGAGCGTTTTGATAA
C
AGTGACCTCTCTGCGTGA


Translation (542 aa):
MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
K
KYAMEQSIKSVLVKQTIAHQQQQLTNLQ
MAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKS
I
DMSWDSVTMKHK
GFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNR
I
YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFI
EYEKAQSSQDAVSSMNLFDLGGQYL
R
VGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQ
EAVAGAAVLGTLGTPGLVSPALTLAQPLGTL
P
QAVMAAQAPGVIT
GVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ
E
HMSISGSSARHMVMQKLLRKQE
STVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEE
D
AEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser