NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27896.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27896.1 Public Mus musculus 15 Hoxc5 21 106 86 CCDS HistoryNCBI Gene:15424Re-query CCDS DB by CCDS ID:27896.1Re-query CCDS DB by GeneID:15424See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27896.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000001709 ENSMUSP00000001709 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001709Link to Ensembl Protein Viewer:ENSMUSP00000001709Re-query CCDS DB by Nucleotide ID:ENSMUST00000001709Re-query CCDS DB by Protein ID:ENSMUSP00000001709
Original member Current member EBI,WTSI OTTMUST00000096505 OTTMUSP00000053931 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000096505Link to Vega Protein Viewer:OTTMUSP00000053931Re-query CCDS DB by Nucleotide ID:OTTMUST00000096505Re-query CCDS DB by Protein ID:OTTMUSP00000053931
Original member Current member NCBI NM_175730.5 NP_783857.1 Accepted alive Link to Nucleotide Sequence:NM_175730.5Link to Protein Sequence:NP_783857.1Re-query CCDS DB by Nucleotide ID:NM_175730Re-query CCDS DB by Protein ID:NP_783857Link to BLAST:NP_783857.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_783857.1 222 P32043 222 100% 0 0

Chromosomal Locations for CCDS 27896.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 103014082 103014535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 103015228 103015442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (669 nt):
ATGAGCTCCTACGTAGCCAATTCATTCTATAAGCAGAGCCCCAATATCCCTGCCTATAACATGCAAACTT
GT
GGGAACTATGGATCGGCCTCAGAGGTGCAGGCATCCAGGTACTGCTACGGCGGATTGGACTTAAGCAT
C
ACTTTCCCACCGCCTGCGCCTTCCAACTCTCTCCACGGGGTAGACATGGCTGCCAACCCCCGGGCTCAC
CCC
GACCGCCCCGCCTGCAGCGCCGCGGCCGCTCCGGGACACGCTCTGGGCAGAGACGAAGCGGCTCCTC
TG
AACCCTGGGATGTACAGTCAGAAGGCGGCTCGCCCGGCGCTGGAGGAGCGAGCTAAGAGCAGTGGGGA
G
ATCAAAGAGGAGCAGGCGCAGACAGGGCAGCCTGCCGGACTGAGCCAGCCACCGGCCCCGCCACAGATT
TAC
CCGTGGATGACCAAACTGCACATGAGCCACGAGACGGATGGCAAGCGGTCCCGAACCAGTTACACGC
GC
TACCAGACCCTGGAACTCGAGAAAGAATTCCATTTTAACCGCTACCTCACTCGCCGCAGGCGCATAGA
G
ATTGCCAACAACTTGTGTCTCAACGAGAGACAGATCAAGATCTGGTTCCAGAACCGCAGGATGAAGTGG
AAG
AAAGATTCCAAAATGAAGAGCAAAGAAGCTCTTTAG


Translation (222 aa):
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAH
P
DRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQI
Y
PWMTKLHMSH
ETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKW
K
KDSKMKSKEAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser