NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25871.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25871.1 Public Mus musculus 12 Nampt 21 106 86 CCDS HistoryNCBI Gene:59027Re-query CCDS DB by CCDS ID:25871.1Re-query CCDS DB by GeneID:59027See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 25871.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020886 ENSMUSP00000020886 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020886Link to Ensembl Protein Viewer:ENSMUSP00000020886Re-query CCDS DB by Nucleotide ID:ENSMUST00000020886Re-query CCDS DB by Protein ID:ENSMUSP00000020886
Original member Current member NCBI NM_021524.2 NP_067499.2 Accepted alive Link to Nucleotide Sequence:NM_021524.2Link to Protein Sequence:NP_067499.2Re-query CCDS DB by Nucleotide ID:NM_021524Re-query CCDS DB by Protein ID:NP_067499Link to BLAST:NP_067499.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067499.2 491 Q99KQ4 491 100% 0 0

Chromosomal Locations for CCDS 25871.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 32820570 32820626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32830167 32830323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32833032 32833135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32834902 32835030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32838299 32838457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32839151 32839287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32840925 32841150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32842685 32842804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32846706 32846846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32848617 32848751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 32850423 32850533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1476 nt):
ATGAATGCTGCGGCAGAAGCCGAGTTCAACATCCTGCTGGCCACCGACTCGTACAAGGTTACTCACTATA
AA
CAATACCCACCCAACACAAGCAAAGTTTATTCCTACTTTGAATGCCGTGAAAAGAAGACAGAAAACTC
C
AAAGTAAGGAAGGTGAAATACGAGGAAACAGTATTTTATGGGTTGCAGTACATTCTTAATAAGTACTTA
AAA
GGTAAAGTAGTGACCAAAGAGAAAATCCAGGAGGCCAAAGAAGTGTACAGAGAACATTTCCAAGATG
AT
GTCTTTAACGAAAGAGGATGGAACTACATCCTTGAGAAATACGATGGTCATCTCCCGATTGAAGTAAA
G
GCTGTTCCCGAGGGCTCTGTCATCCCCAGAGGGAACGTGCTGTTCACAGTGGAAAACACAGACCCAGAG
TGC
TACTGGCTTACCAATTGGATTGAGACTATTCTTGTTCAGTCCTGGTATCCAATTACAGTGGCCACAA
AT
TCCAGAGAACAGAAGAAAATACTGGCCAAATATTTGTTAGAAACCTCTGGTAACTTAGATGGTCTGGA
A
TACAAGTTACATGACTTTGGTTACAGAGGAGTCTCTTCGCAAGAGACTGCTGGCATAGGGGCATCTGCT
CAT
TTGGTTAACTTTAAAGGAACAGATACTGTGGCGGGAATTGCTCTAATTAAAAAATACTATGGGACAA
AA
GATCCTGTTCCAGGCTATTCTGTTCCAGCAGCAGAGCACAGTACCATAACGGCTTGGGGGAAAGACCA
T
GAGAAAGATGCTTTTGAACACATAGTAACACAGTTCTCATCAGTGCCTGTGTCTGTGGTCAGCGATAGC
TAT
GACATTTATAATGCGTGTGAGAAAATATGGGGTGAAGACCTGAGACATCTGATAGTATCGAGAAGTA
CA
GAGGCACCACTAATCATCAGACCTGACTCTGGAAATCCTCTTGACACTGTATTGAAGGTCTTAGATAT
T
TTAGGCAAGAAGTTTCCTGTTACTGAGAACTCAAAAGGCTACAAGTTGCTGCCACCTTATCTTAGAGTC
ATT
CAAGGAGATGGCGTGGATATCAATACTTTACAAGAGATTGTAGAGGGAATGAAACAAAAGAAGTGGA
GT
ATCGAGAATGTCTCCTTCGGTTCTGGTGGCGCTTTGCTACAGAAGTTAACCCGAGACCTCTTGAATTG
C
TCCTTCAAGTGCAGCTATGTTGTAACCAATGGCCTTGGGGTTAATGTGTTTAAGGACCCAGTTGCTGAT
CCC
AACAAAAGGTCAAAAAAGGGCCGGTTATCTTTACATAGGACACCAGCGGGGAACTTTGTTACACTTG
AA
GAAGGAAAAGGAGACCTTGAGGAATATGGCCATGATCTTCTCCATACGGTTTTCAAGAATGGGAAGGT
G
ACAAAAAGCTACTCATTTGATGAAGTCAGAAAAAATGCACAGCTGAACATCGAGCAGGACGTGGCACCT
CAT
TAG


Translation (491 aa):
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFYGLQYILNKYL
K
GKVVTKEKIQEAKEVYREHFQDDVFNERGWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTVENTDPE
C
YWLTNWIE
TILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASA
H
LVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEH
STITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS
Y
DIYNACEKIWGEDLRHLIVSRSTEAPLIIRPDSGNPLDTVLK
VLDILGKKFPVTENSKGYKLLPPYLRV
I
QGDGVDINTLQE
IVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVAD
P
NKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGH
DLLHTVFKNGKVTKSYSFDEVRKNAQLNIEQDVAP
H




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser