NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS14757.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14757.1 Public Homo sapiens X IKBKG 22 109 92 CCDS HistoryNCBI Gene:8517Re-query CCDS DB by CCDS ID:14757.1Re-query CCDS DB by GeneID:8517See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14757.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000594239.5 ENSP00000471166.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000594239.5Link to Ensembl Protein Viewer:ENSP00000471166.1Re-query CCDS DB by Nucleotide ID:ENST00000594239Re-query CCDS DB by Protein ID:ENSP00000471166
Original member Current member EBI,WTSI ENST00000611071.4 ENSP00000479662.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000611071.4Link to Ensembl Protein Viewer:ENSP00000479662.1Re-query CCDS DB by Nucleotide ID:ENST00000611071Re-query CCDS DB by Protein ID:ENSP00000479662
Original member NCBI NM_001099857.2 NP_001093327.1 Updated not alive Link to Nucleotide Sequence:NM_001099857.2Link to Protein Sequence:NP_001093327.1Re-query CCDS DB by Nucleotide ID:NM_001099857Re-query CCDS DB by Protein ID:NP_001093327
NCBI NM_001099857.3 NP_001093327.1 Updated not alive Link to Nucleotide Sequence:NM_001099857.3Link to Protein Sequence:NP_001093327.1Re-query CCDS DB by Nucleotide ID:NM_001099857Re-query CCDS DB by Protein ID:NP_001093327
Current member NCBI NM_001099857.4 NP_001093327.1 Accepted alive Link to Nucleotide Sequence:NM_001099857.4Link to Protein Sequence:NP_001093327.1Re-query CCDS DB by Nucleotide ID:NM_001099857Re-query CCDS DB by Protein ID:NP_001093327Link to BLAST:NP_001093327.1
Original member NCBI NM_001321396.1 NP_001308325.1 Updated not alive Link to Nucleotide Sequence:NM_001321396.1Link to Protein Sequence:NP_001308325.1Re-query CCDS DB by Nucleotide ID:NM_001321396Re-query CCDS DB by Protein ID:NP_001308325
NCBI NM_001321396.2 NP_001308325.1 Updated not alive Link to Nucleotide Sequence:NM_001321396.2Link to Protein Sequence:NP_001308325.1Re-query CCDS DB by Nucleotide ID:NM_001321396Re-query CCDS DB by Protein ID:NP_001308325
Current member NCBI NM_001321396.3 NP_001308325.1 Accepted alive Link to Nucleotide Sequence:NM_001321396.3Link to Protein Sequence:NP_001308325.1Re-query CCDS DB by Nucleotide ID:NM_001321396Re-query CCDS DB by Protein ID:NP_001308325Link to BLAST:NP_001308325.1
Original member Current member NCBI NM_003639.4 NP_003630.1 Accepted alive Link to Nucleotide Sequence:NM_003639.4Link to Protein Sequence:NP_003630.1Re-query CCDS DB by Nucleotide ID:NM_003639Re-query CCDS DB by Protein ID:NP_003630Link to BLAST:NP_003630.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001093327.1 419 Q9Y6K9-1 419 100% 0 0
NP_001308325.1 419 Q9Y6K9-1 419 100% 0 0
NP_003630.1 419 Q9Y6K9-1 419 100% 0 0

Chromosomal Locations for CCDS 14757.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 154552003 154552189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154556165 154556376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154558532 154558650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154560407 154560559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154561688 154561784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154562810 154562953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154563559 154563701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154563959 154564020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 154564319 154564461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1260 nt):
ATGAATAGGCACCTCTGGAAGAGCCAACTGTGTGAGATGGTGCAGCCCAGTGGTGGCCCGGCAGCAGATC
AG
GACGTACTGGGCGAAGAGTCTCCTCTGGGGAAGCCAGCCATGCTGCACCTGCCTTCAGAACAGGGCGC
T
CCTGAGACCCTCCAGCGCTGCCTGGAGGAGAATCAAGAGCTCCGAGATGCCATCCGGCAGAGCAACCAG
ATT
CTGCGGGAGCGCTGCGAGGAGCTTCTGCATTTCCAAGCCAGCCAGAGGGAGGAGAAGGAGTTCCTCA
TG
TGCAAGTTCCAGGAGGCCAGGAAACTGGTGGAGAGACTCGGCCTGGAGAAGCTCGATCTGAAGAGGCA
G
AAGGAGCAGGCTCTGCGGGAGGTGGAGCACCTGAAGAGATGCCAGCAGCAGATGGCTGAGGACAAGGCC
TCT
GTGAAAGCCCAGGTGACGTCCTTGCTCGGGGAGCTGCAGGAGAGCCAGAGTCGCTTGGAGGCTGCCA
CT
AAGGAATGCCAGGCTCTGGAGGGTCGGGCCCGGGCGGCCAGCGAGCAGGCGCGGCAGCTGGAGAGTGA
G
CGCGAGGCGCTGCAGCAGCAGCACAGCGTGCAGGTGGACCAGCTGCGCATGCAGGGCCAGAGCGTGGAG
GCC
GCGCTCCGCATGGAGCGCCAGGCCGCCTCGGAGGAGAAGAGGAAGCTGGCCCAGTTGCAGGTGGCCT
AT
CACCAGCTCTTCCAAGAATACGACAACCACATCAAGAGCAGCGTGGTGGGCAGTGAGCGGAAGCGAGG
A
ATGCAGCTGGAAGATCTCAAACAGCAGCTCCAGCAGGCCGAGGAGGCCCTGGTGGCCAAACAGGAGGTG
ATC
GATAAGCTGAAGGAGGAGGCCGAGCAGCACAAGATTGTGATGGAGACCGTTCCGGTGCTGAAGGCCC
AG
GCGGATATCTACAAGGCGGACTTCCAGGCTGAGAGGCAGGCCCGGGAGAAGCTGGCCGAGAAGAAGGA
G
CTCCTGCAGGAGCAGCTGGAGCAGCTGCAGAGGGAGTACAGCAAACTGAAGGCCAGCTGTCAGGAGTCG
GCC
AGGATCGAGGACATGAGGAAGCGGCATGTCGAGGTCTCCCAGGCCCCCTTGCCCCCCGCCCCTGCCT
AC
CTCTCCTCTCCCCTGGCCCTGCCCAGCCAGAGGAGGAGCCCCCCCGAGGAGCCACCTGACTTCTGCTG
T
CCCAAGTGCCAGTATCAGGCCCCTGATATGGACACCCTGCAGATACATGTCATGGAGTGCATTGAGTAG


Translation (419 aa):
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ
I
LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ
QMAEDKA
S
VKAQVTSLLGELQESQSRLEAATKECQALEG
RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE
A
ALRMERQAASEE
KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV
I
DKLKEEAEQHKIVMETVPVLKAQ
ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES
A
RIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser