NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS12526.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12526.1 Public Homo sapiens 19 FBXO17 22 109 92 CCDS HistoryNCBI Gene:115290Re-query CCDS DB by CCDS ID:12526.1Re-query CCDS DB by GeneID:115290See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12526.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000292852.8 ENSP00000292852.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000292852.8Link to Ensembl Protein Viewer:ENSP00000292852.3Re-query CCDS DB by Nucleotide ID:ENST00000292852Re-query CCDS DB by Protein ID:ENSP00000292852
Original member Current member EBI,WTSI ENST00000595329.5 ENSP00000470361.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000595329.5Link to Ensembl Protein Viewer:ENSP00000470361.1Re-query CCDS DB by Nucleotide ID:ENST00000595329Re-query CCDS DB by Protein ID:ENSP00000470361
Original member NCBI NM_024907.6 NP_079183.4 Updated not alive Link to Nucleotide Sequence:NM_024907.6Link to Protein Sequence:NP_079183.4Re-query CCDS DB by Nucleotide ID:NM_024907Re-query CCDS DB by Protein ID:NP_079183
Current member NCBI NM_024907.7 NP_079183.4 Accepted alive Link to Nucleotide Sequence:NM_024907.7Link to Protein Sequence:NP_079183.4Re-query CCDS DB by Nucleotide ID:NM_024907Re-query CCDS DB by Protein ID:NP_079183Link to BLAST:NP_079183.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079183.4 278 Q96EF6 278 100% 0 0

Chromosomal Locations for CCDS 12526.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 38942608 38942751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 38944969 38945104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 38946472 38946567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 38948567 38948678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 38949971 38950319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (837 nt):
ATGGGCGCCCGGCTATCGCGGCGACGGCTGCCGGCGGACCCATCCCTGGCCCTGGACGCGCTGCCCCCGG
AG
CTGCTGGTGCAGGTGCTGAGCCACGTGCCGCCACGCTCCTTGGTCACGCGATGCCGCCCAGTGTGCCG
C
GCCTGGCGCGACATAGTGGACGGGCCCACTGTGTGGCTGCTGCAGCTGGCCCGCGACCGCAGCGCCGAG
GGC
CGCGCACTCTACGCAGTGGCTCAACGCTGCCTGCCCAGCAACGAAGACAAGGAGGAGTTCCCGCTGT
GC
GCCCTGGCGCGCTACTGTCTGCGCGCGCCCTTCGGCCGCAATCTCATCTTCAACTCCTGCGGAGAGCA
G
GGCTTCAGAGGCTGGGAGGTGGAGCATGGCGGGAACGGCTGGGCCATAGAAAAGAACCTAACACCGGTG
CCT
GGGGCTCCTTCGCAGACCTGCTTCGTGACCTCTTTCGAATGGTGCTCCAAGAGGCAGCTTGTGGACC
TG
GTGATGGAAGGGGTGTGGCAGGAGCTGCTGGACAGCGCCCAGATTGAGATCTGTGTGGCTGACTGGTG
G
GGCGCTCGAGAGAACTGCGGCTGCGTCTACCAGCTCCGGGTCCGCCTTCTGGATGTGTATGAAAAGGAA
GTG
GTCAAGTTCTCAGCCTCACCTGACCCGGTCCTTCAGTGGACTGAGAGGGGCTGCCGACAGGTCTCCC
AC
GTCTTCACCAACTTTGGCAAGGGCATCCGCTACGTATCTTTTGAGCAGTACGGGAGAGACGTGAGTTC
C
TGGGTGGGGCACTATGGCGCCCTTGTGACCCACTCCAGTGTGAGGGTCAGGATCCGTCTGTCCTAG


Translation (278 aa):
MGARLSRRRLPADPSLALDALPPELLVQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAE
G
RALYAVAQRCLPSNEDKEEFPLCALARYCLRAPFGRNLIFNSCGE
QGFRGWEVEHGGNGWAIEKNLTPV
P
GAPSQTCFVTSF
EWCSKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKE
V
VKFSASPDPVLQWTERGCRQ
VSHVFTNFGKGIRYVSFEQYGRDVSSWVGHYGALVTHSSVRVRIRLS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser