Display Settings:

Format

Send to:

Choose Destination

    Agric Biol Chem. 1991 Jul;55(7):1701-6.

    The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.

    Araki T, Kudo K, Kuramoto M, Torikata T.

    Laboratory of Biochemistry, Faculty of Agriculture, Kyushu Tokai University, Kumamoto, Japan.

    The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAW- VAWRNRCKGTDVSVWTRGCRL. This sequence had 9 amino acid substitutions compared with hen egg-white lysozyme. Two of these substitutions, positions 34 and 121, were newly detected in phasianid birds. The protein genealogy of phasianid bird lysozymes showed some discordance with the morphological classification of these birds.

    PMID: 1368712 [PubMed - indexed for MEDLINE]

    Supplemental Content