Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My NCBI Filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1996 1
1999 1
2002 1
2004 1
2006 1
2009 1
2010 1
2013 2
2014 1
2015 2
2017 4
2018 4
2019 3
2020 5
2021 8
2022 1
2023 2
2024 3

Text availability

Article attribute

Article type

Publication date

Search Results

39 results

Results by year

Filters applied: . Clear all
Your search was processed without automatic term mapping because it retrieved zero results.
The following terms were ignored: %, %, %, %
The following terms were not found in PubMed: 22Eisen, 5BAuthor
Page 1
Patient-reported outcomes of upadacitinib versus abatacept in patients with rheumatoid arthritis and an inadequate response to biologic disease-modifying antirheumatic drugs: 12- and 24-week results of a phase 3 trial.
Bergman M, Tundia N, Martin N, Suboticki JL, Patel J, Goldschmidt D, Song Y, Wright GC. Bergman M, et al. Arthritis Res Ther. 2022 Jun 24;24(1):155. doi: 10.1186/s13075-022-02813-x. Arthritis Res Ther. 2022. PMID: 35751108 Free PMC article. Clinical Trial.
PROs evaluated included Patient Global Assessment of Disease Activity (PtGA) by visual analog scale (VAS), patient's assessment of pain by VAS, Health Assessment Questionnaire Disability Index (HAQ-DI), morning stiffness duration and severity, 36-Item Short Form Health Survey (SF …
PROs evaluated included Patient Global Assessment of Disease Activity (PtGA) by visual analog scale (VAS), patient's assessment of pain by V …
Protein Micropatterning in 2.5D: An Approach to Investigate Cellular Responses in Multi-Cue Environments.
van der Putten C, Buskermolen ABC, Werner M, Brouwer HFM, Bartels PAA, Dankers PYW, Bouten CVC, Kurniawan NA. van der Putten C, et al. ACS Appl Mater Interfaces. 2021 Jun 9;13(22):25589-25598. doi: 10.1021/acsami.1c01984. Epub 2021 May 25. ACS Appl Mater Interfaces. 2021. PMID: 34032413 Free PMC article.
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a two-and-a-half-dimensional (2.5D) cell culture chip containing a library of well-defined microstructures (resembling topographical c …
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Yield-Related QTL Clusters and the Potential Candidate Genes in Two Wheat DH Populations.
Zhang J, She M, Yang R, Jiang Y, Qin Y, Zhai S, Balotf S, Zhao Y, Anwar M, Alhabbar Z, Juhász A, Chen J, Liu H, Liu Q, Zheng T, Yang F, Rong J, Chen K, Lu M, Islam S, Ma W. Zhang J, et al. Int J Mol Sci. 2021 Nov 3;22(21):11934. doi: 10.3390/ijms222111934. Int J Mol Sci. 2021. PMID: 34769361 Free PMC article.
The QTL clusters with consistently positive correlations were suggested to be directly utilized in wheat breeding, including 1B.2, 2A.2, 2B (4.9-16.5 Mb), 2B.3, 3B (68.9-214.5 Mb), 4A.2, 4B.2, 4D, 5A.1, 5A.2, 5B.1, and 5D. ...Another GPC QTL without negativel …
The QTL clusters with consistently positive correlations were suggested to be directly utilized in wheat breeding, including 1B.2, 2A.2, 2B …
Complications and outcome after rib fracture fixation: A systematic review.
Peek J, Beks RB, Hietbrink F, Heng M, De Jong MB, Beeres FJP, Leenen LPH, Groenwold RHH, Houwert RM. Peek J, et al. J Trauma Acute Care Surg. 2020 Aug;89(2):411-418. doi: 10.1097/TA.0000000000002716. J Trauma Acute Care Surg. 2020. PMID: 32282759
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies reporting on the EQ-5D had a weighted mean EQ-5D index of 0.80 indicating good quality of life after rib fracture fixation. ...
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies repo …
Are lanthanide-transition metal direct bonds a route to achieving new generation {3d-4f} SMMs?
Swain A, Sen A, Rajaraman G. Swain A, et al. Dalton Trans. 2021 Nov 16;50(44):16099-16109. doi: 10.1039/d1dt02256c. Dalton Trans. 2021. PMID: 34647556
Bonding analysis reveals a dative Ln-TM bond with a donation of pi(V/Mnd(xy)-pi*CO) to 5d(z(2)) (Gd) in the case of Gd-V and Gd-Mn and 4s(Co) to 5d(xy)/5d(yz) (Gd) for Gd-Co with the transition metal ion being found in the low-spin S = configurations in all t …
Bonding analysis reveals a dative Ln-TM bond with a donation of pi(V/Mnd(xy)-pi*CO) to 5d(z(2)) (Gd) in the case of Gd-V and Gd-Mn an …
Design, synthesis, in vitro and in silico evaluation of indole-based tetrazole derivatives as putative anti-breast cancer agents.
Kaur K, Verma H, Gangwar P, Dhiman M, Jaitak V. Kaur K, et al. RSC Med Chem. 2024 Feb 19;15(4):1329-1347. doi: 10.1039/d3md00730h. eCollection 2024 Apr 24. RSC Med Chem. 2024. PMID: 38665833
The compounds exhibited in vitro anti-proliferative activity against ER-alpha positive T-47D (IC(50) = 3.82-24.43 muM), MCF-7 (IC(50) = 3.08-22.65 muM), and ER-alpha negative MDA-MB-231 (IC(50) = 7.69-19.4 muM) human breast cancer cell lines. ...Western blot analysi …
The compounds exhibited in vitro anti-proliferative activity against ER-alpha positive T-47D (IC(50) = 3.82-24.43 muM), MCF-7 (IC(50) = 3.08 …
Patient-specific plate for navigation and fixation of the distal radius: a case series.
Dobbe JGG, Peymani A, Roos HAL, Beerens M, Streekstra GJ, Strackee SD. Dobbe JGG, et al. Int J Comput Assist Radiol Surg. 2021 Mar;16(3):515-524. doi: 10.1007/s11548-021-02320-5. Epub 2021 Feb 11. Int J Comput Assist Radiol Surg. 2021. PMID: 33575933 Free PMC article.
Pre- and postoperative results were pooled and demonstrated significant correlations between: (1) pain and malpositioning, (2) the range of pro- and supination motion, the MHOQ score, the EQ-5D-5L score and dorsovolar angulation, and (3) MHOQ score and proximodistal transl …
Pre- and postoperative results were pooled and demonstrated significant correlations between: (1) pain and malpositioning, (2) the range of …
Five-Year Outcomes of a Randomized Trial of Treatments for Varicose Veins.
Brittenden J, Cooper D, Dimitrova M, Scotland G, Cotton SC, Elders A, MacLennan G, Ramsay CR, Norrie J, Burr JM, Campbell B, Bachoo P, Chetter I, Gough M, Earnshaw J, Lees T, Scott J, Baker SA, Tassie E, Francis J, Campbell MK. Brittenden J, et al. N Engl J Med. 2019 Sep 5;381(10):912-922. doi: 10.1056/NEJMoa1805186. N Engl J Med. 2019. PMID: 31483962 Free article. Clinical Trial.
Primary outcomes at 5 years were disease-specific quality of life and generic quality of life, as well as cost-effectiveness based on models of expected costs and quality-adjusted life-years (QALYs) gained that used data on participants' treatment costs and scores on the EuroQol …
Primary outcomes at 5 years were disease-specific quality of life and generic quality of life, as well as cost-effectiveness based on models …
Phytoceramides from the Marine Sponge Monanchora clathrata: Structural Analysis and Cytoprotective Effects.
Santalova EA, Kuzmich AS, Chingizova EA, Menchinskaya ES, Pislyagin EA, Dmitrenok PS. Santalova EA, et al. Biomolecules. 2023 Apr 14;13(4):677. doi: 10.3390/biom13040677. Biomolecules. 2023. PMID: 37189423 Free PMC article.
Total ceramide, ceramide molecular species (obtained by RP-HPLC, high-performance liquid chromatography on reversed-phase column) and their sphingoid/fatty acid components were analyzed by NMR (nuclear magnetic resonance) spectroscopy and mass spectrometry. Sixteen new (1b, 3a, 3 …
Total ceramide, ceramide molecular species (obtained by RP-HPLC, high-performance liquid chromatography on reversed-phase column) and their …
39 results