NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23370.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23370.1 Public Mus musculus 9 Htr1b 19 105 81 CCDS HistoryNCBI Gene:15551Re-query CCDS DB by CCDS ID:23370.1Re-query CCDS DB by GeneID:15551See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23370.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000051005 ENSMUSP00000050898 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051005Link to Ensembl Protein Viewer:ENSMUSP00000050898Re-query CCDS DB by Nucleotide ID:ENSMUST00000051005Re-query CCDS DB by Protein ID:ENSMUSP00000050898
Original member Current member EBI,WTSI ENSMUST00000183482 ENSMUSP00000139389 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000183482Link to Ensembl Protein Viewer:ENSMUSP00000139389Re-query CCDS DB by Nucleotide ID:ENSMUST00000183482Re-query CCDS DB by Protein ID:ENSMUSP00000139389
Original member Current member EBI,WTSI OTTMUST00000117899 OTTMUSP00000065857 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000117899Link to Vega Protein Viewer:OTTMUSP00000065857Re-query CCDS DB by Nucleotide ID:OTTMUST00000117899Re-query CCDS DB by Protein ID:OTTMUSP00000065857
Original member Current member NCBI NM_010482.1 NP_034612.1 Accepted alive Link to Nucleotide Sequence:NM_010482.1Link to Protein Sequence:NP_034612.1Re-query CCDS DB by Nucleotide ID:NM_010482Re-query CCDS DB by Protein ID:NP_034612Link to BLink:NP_034612.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034612.1 386 P28334 386 100% 0 0

Chromosomal Locations for CCDS 23370.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 81631392 81632552 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1161 nt):
ATGGAGGAGCAGGGTATTCAGTGCGCCCCGCCGCCTCCCGCCGCCTCCCAGACAGGGGTACCTCTCACCA
AC
CTCTCCCACAACTGCAGCGCCGACGGCTACATTTACCAGGACTCCATCGCCCTGCCCTGGAAAGTCCT
G
CTGGTTGCTTTGTTGGCGCTCATCACCTTGGCCACCACGCTCTCCAACGCCTTTGTAATCGCTACGGTG
TAT
CGGACCCGGAAGCTACACACCCCGGCTAACTACCTGATCGCCTCTCTGGCAGTCACTGACCTGCTCG
TG
TCCATCCTGGTGATGCCCATCAGCACCATGTACACGGTCACTGGACGCTGGACACTAGGCCAGGTGGT
C
TGCGACTTCTGGCTGTCGTCGGATATCACCTGTTGCACTGCTTCCATCATGCATCTCTGTGTCATCGCC
CTG
GACCGCTACTGGGCCATCACCGATGCGGTGGAGTATTCTGCTAAAAGGACTCCCAAAAGGGCGGCCA
TC
ATGATCGTGCTGGTGTGGGTCTTCTCCATCTCTATTTCGTTGCCACCCTTCTTCTGGCGTCAAGCCAA
A
GCAGAGGAGGAGATGCTGGACTGCTTTGTGAACACCGACCACGTCCTCTACACGGTCTACTCCACGGTG
GGC
GCTTTCTATTTACCCACCCTGCTCCTCATCGCCCTCTATGGCCGCATCTATGTGGAAGCCCGCTCTC
GG
ATTTTGAAACAGACACCCAACAAGACCGGCAAGCGCTTGACCCGAGCCCAGTTGATAACAGACTCCCC
G
GGATCCACATCCTCGGTCACCTCCATTAACTCCCGGGCTCCGGACGTGCCCAGTGAGTCCGGGTCTCCT
GTG
TACGTGAACCAAGTCAAAGTGCGAGTCTCAGACGCCCTGCTGGAAAAGAAGAAACTCATGGCCGCTA
GG
GAGCGCAAAGCCACCAAGACCCTAGGGATCATTTTAGGAGCATTTATTGTGTGTTGGCTGCCCTTCTT
C
ATCATCTCCCTGGTGATGCCTATCTGTAAGGATGCCTGCTGGTTTCACATGGCCATTTTTGACTTCTTC
AAT
TGGTTAGGCTATCTTAACTCCCTCATCAACCCCATCATCTACACCATGTCCAATGAGGACTTCAAAC
AA
GCGTTCCACAAACTGATACGCTTTAAGTGCGCAGGTTGA


Translation (386 aa):
MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATTLSNAFVIATV
Y
RTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIA
L
DRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFFWRQAKAEEEMLDCFVNTDHVLYTVYSTV
G
AFYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSP
V
YVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFF
N
WLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCAG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser