NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27219.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27219.1 Public Mus musculus 14 Chrna2 16 104 75 CCDS HistoryNCBI Gene:110902Re-query CCDS DB by CCDS ID:27219.1Re-query CCDS DB by GeneID:110902See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27219.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022620 ENSMUSP00000022620 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022620Link to Ensembl Protein Viewer:ENSMUSP00000022620Re-query CCDS DB by Nucleotide ID:ENSMUST00000022620Re-query CCDS DB by Protein ID:ENSMUSP00000022620
Original member Current member EBI,WTSI OTTMUST00000103500 OTTMUSP00000057835 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000103500Link to Vega Protein Viewer:OTTMUSP00000057835Re-query CCDS DB by Nucleotide ID:OTTMUST00000103500Re-query CCDS DB by Protein ID:OTTMUSP00000057835
Original member Current member NCBI NM_144803.2 NP_659052.1 Accepted alive Link to Nucleotide Sequence:NM_144803.2Link to Protein Sequence:NP_659052.1Re-query CCDS DB by Nucleotide ID:NM_144803Re-query CCDS DB by Protein ID:NP_659052Link to BLink:NP_659052.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659052.1 512 Q91X60 512 100% 0 0

Chromosomal Locations for CCDS 27219.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 66142214 66142286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 66143357 66143508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 66143921 66143965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 66146406 66146515 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 66148787 66149819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 66150951 66151076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1539 nt):
ATGGCCCCCTCCCATCCTGCTTTCCAGTTCTGGATACATCTTTATCTCTGGTGTCTGCTTCTGATGCCAG
CA
GTGTTGGCCCAGCAAGGCTCGCACACCCATGCCGAGGACCGCCTGTTCAAACACCTCTTTGGAGGCTA
C
AATCGCTGGGCACGGCCAGTGCCCAACACTTCCGATGTGGTCATCGTGCGCTTTGGACTATCCATTGCA
CAG
CTCATAGATGTGGATGAGAAGAATCAAATGATGACCACCAATGTCTGGCTAAAGCAGGAATGGAATG
AC
TACAAGCTGCGCTGGGACCCGGCTGAGTTTGGCAACATCACCTCCCTCCGCGTCCCCTCAGAGATGAT
C
TGGATCCCAGACATTGTTCTCTACAACAATGCAGACGGGGAGTTTGCGGTGACCCACATGACCAAGGCC
CAC
CTCTTCTTCACGGGCACTGTGCACTGGGTGCCCCCAGCCATCTACAAGAGCTCCTGCAGCATCGACG
TG
ACTTTCTTCCCCTTCGACCAGCAGAACTGCAAGATGAAGTTTGGCTCCTGGACATACGACAAGGCCAA
G
ATCGACCTGGAGCAGATGGAGCGGACGGTGGACCTGAAGGACTACTGGGAGAGCGGCGAGTGGGCCATT
ATC
AACGCCACCGGAACCTATAACAGCAAGAAGTACGACTGCTGCGCGGAGATCTACCCCGACGTCACCT
AC
TACTTCGTTATCCGCCGGCTGCCGCTGTTCTACACCATCAACCTCATTATCCCGTGCCTGCTCATCTC
C
TGCCTCACCGTGCTCGTGTTCTACTTGCCCTCTGAGTGTGGAGAGAAGATCACGCTGTGCATCTCGGTG
CTG
CTCTCCCTCACTGTCTTCCTGCTGCTCATCACAGAAATTATCCCATCCACCTCACTGGTCATCCCAC
TC
ATCGGCGAGTACCTGCTCTTCACCATGATCTTCGTCACCCTCTCTATTGTGATCACAGTCTTCGTGCT
C
AATGTCCACCACCGTTCCCCTAGCACGCACAACATGCCCAACTGGGTGAGGGTGGCCCTGCTAGGCCGG
GTG
CCCCGGTGGCTGATGATGAATCGGCCCCTGCCGCCCATGGAGCTCCATGGCTCTCCAGGTCTGAAGC
TC
AGCCCCACTTATCATTGGCTGGAGACCAACATGGATGCTGAAGAAAGGGAGGAGACAGAGGAAGAGGA
G
GAGGAGGAAGAAGATGAAAACATATGTATGTGTGCAGGCCTCCCAGACTCTTCCATGGGTGTCCTCTAT
GGC
CATGGCAGCCTGCATCTGAGGGCCATGGGGCCTGAGGCCAAGACTCCATCCCAGGCTAGTGAGATCC
TG
CTGTCACCTCAAATACAGAAAGCACTAGAAGGTGTACACTACATTGCTGACCACCTGAGGTCTGAGGA
T
GCTGACTCTTCGGTGAAGGAAGATTGGAAGTATGTGGCCATGGTGGTAGACCGGATCTTCCTCTGGCTG
TTC
ATTATCGTCTGCTTCCTGGGGACCATCGGGCTCTTCCTCCCTCCGTTCCTGGCTGGAATGATCTGA


Translation (512 aa):
MAPSHPAFQFWIHLYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIA
Q
LIDV
DEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKA
H
LFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMERTVDLKDYWESGEWAI
I
NATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISV
L
LSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGR
V
PRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLY
G
HGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSS
VKEDWKYVAMVVDRIFLWL
F
IIVCFLGTIGLFLPPFLAGMI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser