NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29466.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29466.1 Public Mus musculus 19 Efemp2 16 104 75 CCDS HistoryNCBI Gene:58859Re-query CCDS DB by CCDS ID:29466.1Re-query CCDS DB by GeneID:58859See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29466.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165485 ENSMUSP00000133016 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165485Link to Ensembl Protein Viewer:ENSMUSP00000133016Re-query CCDS DB by Nucleotide ID:ENSMUST00000165485Re-query CCDS DB by Protein ID:ENSMUSP00000133016
Original member Current member EBI,WTSI OTTMUST00000094312 OTTMUSP00000052420 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000094312Link to Vega Protein Viewer:OTTMUSP00000052420Re-query CCDS DB by Nucleotide ID:OTTMUST00000094312Re-query CCDS DB by Protein ID:OTTMUSP00000052420
Original member Current member NCBI NM_021474.3 NP_067449.3 Accepted alive Link to Nucleotide Sequence:NM_021474.3Link to Protein Sequence:NP_067449.3Re-query CCDS DB by Nucleotide ID:NM_021474Re-query CCDS DB by Protein ID:NP_067449Link to BLink:NP_067449.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067449.3 443 Q9WVJ9 443 100% 0 0

Chromosomal Locations for CCDS 29466.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 5475068 5475178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5475408 5475456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5476066 5476272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5477562 5477684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5477927 5478043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5478201 5478320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480030 5480149 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480234 5480360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480546 5480741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5481561 5481722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1332 nt):
ATGCTCCCTTTTGCCTCCTGCCTCCCCGGGTCTTTGCTGCTCTGGGCGTTTCTGCTGTTGCTCTTGGGAG
CA
GCGTCCCCACAGGATCCCGAGGAGCCGGACAGCTACACGGAATGCACAGATGGCTATGAGTGGGATGC
A
GACAGCCAGCACTGCCGGGATGTCAACGAGTGCCTGACCATCCCGGAGGCTTGCAAGGGTGAGATGAAA
TGC
ATCAACCACTACGGGGGTTATTTGTGTCTGCCTCGCTCTGCTGCCGTCATCAGTGATCTCCATGGTG
AA
GGACCTCCACCGCCAGCGGCCCATGCTCAACAACCAAACCCTTGCCCGCAGGGCTACGAGCCTGATGA
A
CAGGAGAGCTGTGTGGATGTGGACGAGTGTACCCAGGCTTTGCATGACTGTCGCCCTAGTCAGGACTGC
CAT
AACCTTCCTGGCTCCTACCAGTGCACCTGCCCTGATGGTTACCGAAAAATTGGACCCGAATGTGTGG
AC
ATAGATGAGTGTCGTTACCGCTATTGCCAGCATCGATGTGTGAACCTGCCGGGCTCTTTTCGATGCCA
G
TGTGAGCCAGGCTTCCAGTTGGGACCTAACAACCGCTCTTGTGTGGATGTGAATGAGTGTGACATGGGA
GCC
CCATGTGAGCAGCGCTGCTTCAACTCCTATGGGACCTTCCTGTGTCGCTGTAACCAGGGCTATGAGC
TG
CACCGGGATGGCTTCTCCTGCAGCGATATCGATGAGTGCGGCTACTCCAGTTACCTCTGCCAGTACCG
C
TGTGTCAACGAGCCAGGCCGATTCTCCTGTCACTGCCCACAAGGCTACCAGCTGCTGGCTACAAGGCTC
TGC
CAAGATATTGACGAGTGTGAAACAGGTGCACACCAATGTTCTGAGGCCCAAACCTGTGTCAACTTCC
AT
GGGGGTTACCGCTGTGTGGACACCAACCGTTGTGTGGAGCCCTATGTCCAAGTGTCAGACAACCGCTG
C
CTCTGCCCTGCCTCCAATCCCCTTTGTCGAGAGCAGCCTTCATCCATTGTGCACCGCTACATGAGCATC
ACC
TCAGAGCGAAGTGTGCCTGCTGACGTGTTTCAGATCCAGGCAACCTCTGTCTACCCTGGTGCCTACA
AT
GCCTTTCAGATCCGTTCTGGAAACACACAGGGGGACTTCTACATTAGGCAAATCAACAATGTCAGCGC
C
ATGCTGGTCCTCGCCAGGCCAGTGACGGGACCCCGGGAGTACGTGCTGGACCTGGAGATGGTCACCATG
AAT
TCCCTTATGAGCTACCGGGCCAGCTCTGTACTGAGACTCACGGTCTTTGTGGGAGCCTATACCTTCT
GA


Translation (443 aa):
MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEWDADSQHCRDVNECLTIPEACKGEMK
C
INHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQESCV
DVDECTQALHDCRPSQDC
H
NLPGSYQCTCPDGYRKIGPECV
DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMG
A
PCEQRCFNSYGTFLCRCNQGYELHRDGFSCS
DIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRL
C
Q
DIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSI
T
SERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIR
QINNVSAMLVLARPVTGPREYVLDLEMVTM
N
SLMSYRASSVLRLTVFVGAYTF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser