NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49017.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49017.1 Public Mus musculus 12 Adcy3 16 104 75 CCDS HistoryNCBI Gene:104111Re-query CCDS DB by CCDS ID:49017.1Re-query CCDS DB by GeneID:104111See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49017.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000152065 ENSMUSP00000115644 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000152065Link to Ensembl Protein Viewer:ENSMUSP00000115644Re-query CCDS DB by Nucleotide ID:ENSMUST00000152065Re-query CCDS DB by Protein ID:ENSMUSP00000115644
Original member Current member EBI,WTSI ENSMUST00000124505 ENSMUSP00000122073 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000124505Link to Ensembl Protein Viewer:ENSMUSP00000122073Re-query CCDS DB by Nucleotide ID:ENSMUST00000124505Re-query CCDS DB by Protein ID:ENSMUSP00000122073
Original member Current member EBI,WTSI OTTMUST00000084969 OTTMUSP00000045854 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084969Link to Vega Protein Viewer:OTTMUSP00000045854Re-query CCDS DB by Nucleotide ID:OTTMUST00000084969Re-query CCDS DB by Protein ID:OTTMUSP00000045854
Original member Current member EBI,WTSI OTTMUST00000084970 OTTMUSP00000045855 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084970Link to Vega Protein Viewer:OTTMUSP00000045855Re-query CCDS DB by Nucleotide ID:OTTMUST00000084970Re-query CCDS DB by Protein ID:OTTMUSP00000045855
Original member Current member NCBI NM_001159536.1 NP_001153008.1 Accepted alive Link to Nucleotide Sequence:NM_001159536.1Link to Protein Sequence:NP_001153008.1Re-query CCDS DB by Nucleotide ID:NM_001159536Re-query CCDS DB by Protein ID:NP_001153008Link to BLink:NP_001153008.1
Original member Current member NCBI NM_001159537.1 NP_001153009.1 Accepted alive Link to Nucleotide Sequence:NM_001159537.1Link to Protein Sequence:NP_001153009.1Re-query CCDS DB by Nucleotide ID:NM_001159537Re-query CCDS DB by Protein ID:NP_001153009Link to BLink:NP_001153009.1

Chromosomal Locations for CCDS 49017.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 4134326 4135000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4173455 4173604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4194317 4194447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4194866 4194977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4195132 4195259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4196764 4196922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4198295 4198469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4199305 4199433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4200902 4201044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4201182 4201343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4203514 4203601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4204722 4204838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4206365 4206624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4206913 4206978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4208580 4208661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4209305 4209463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4210194 4210340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4210772 4210891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4211482 4211605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4212079 4212203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4212605 4212787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3435 nt):
ATGCCGAGGAACCAGGGCTTCTCGGATCCCGAGTACTCGGCAGAGTACTCAGCTGAATACTCGGTCAGCC
TG
CCCTCTGACCCCGACCGCGGGGTCGGCCGGACCCATGAAATTTCTGTGCGGAACTCGGGGTCCTGCCT
G
TGCCTGCCTCGCTTTATGCGGCTGACCTTCGTGCCTGAGTCCTTGGAGAACCTCTACCAGACCTACTTC
AAA
AGGCAGCGCCATGAGACCCTGCTGGTGCTGGTGGTCTTTGCGGCCCTCTTTGACTGCTACGTGGTAG
TG
ATGTGCGCGGTGGTCTTCTCCAGCGACAAGCTGGCGCCCCTCATGGTGGCAGGCTTCGGTCTGGTGTT
G
GACATCATCCTTTTCGTGCTCTGTAAAAAGGGGCTGCTCCCGGACCGAGTGAGCCGCAAAGTGGTACCC
TAC
CTGCTGTGGCTGCTCATCTCGGCCCAGATCTTCTCCTACCTGGGCCTGAACTTTTCACGGGCCCACG
CA
GCCAGTGACACTGTGGGTTGGCAGGCTTTCTTTGTCTTCTCCTTCTTCATAACGCTGCCCCTCAGCCT
C
AGCCCCATCGTGATCATCTCTGTGGTCTCCTGTGTTGTGCACACGCTTGTGTTGGGGGTCACTGTGGCC
CAG
CAGCAGCAGGATGAGCTGGAAGGGATGCAGCTGCTGAGGGAGATCCTGGCCAACGTCTTCCTCTACC
TG
TGTGCTATCATCGTGGGCATCATGTCCTACTACATGGCAGACCGCAAGCACCGCAAGGCCTTCCTGGA
G
GCCCGCCAGTCACTGGAGGTGAAGATGAATCTGGAGGAGCAGAGCCAGCAGCAGGAAAACCTTATGCTT
TCC
ATCCTGCCCAAGCACGTGGCTGACGAGATGCTGAAGGACATGAAGAAGGACGAGAGCCAGAAGGACC
AG
CAGCAGTTCAATACCATGTACATGTACCGGCACGAGAATGTCAGCATCCTGTTTGCAGATATTGTGGG
C
TTTACCCAGCTGTCCTCTGCTTGCAGTGCCCAGGAGCTCGTGAAGTTACTCAACGAGCTCTTCGCCCGC
TTT
GACAAGCTGGCAGCCAAATACCACCAGCTGAGGATCAAGATCCTAGGCGACTGTTACTACTGCATCT
GC
GGCTTGCCTGACTACCGGGAGGACCATGCCGTGTGCTCCATCCTTATGGGGCTTGCCATGGTAGAGGC
C
ATCTCGTACGTGCGGGAGAAGACCAAGACTGGAGTGGACATGCGTGTGGGAGTGCACACAGGCACTGTC
CTA
GGCGGTGTCCTGGGCCAGAAGCGCTGGCAGTATGATGTATGGTCTACTGATGTCACCGTGGCAAACA
AG
ATGGAGGCTGGTGGCATCCCAGGGCGCGTGCACATTTCCCAGAGCACCATGGACTGCCTGAAGGGGGA
G
TTTGATGTGGAGCCTGGTGATGGGGGCAGTCGCTGCGACTACCTAGATGAGAAGGGCATCGAAACCTAC
CTC
ATCATTGCCTCCAAGCCAGAGGTGAAGAAAACAGCCCAAAATGGCCTCAACGGCTCGGCCGTGCCAA
AC
GGAGCGCCGGCATCCTCCAAACCCAGCTCCCCTGCCCTCATCGAGACCAAGGAGCCCAATGGAAGTGC
C
CATGCCAGCGGCTCCACATCAGAGGAGGCTGAAGAACAGGAGGCCCAGGCTGACAACCCCTCGTTCCCC
AAC
CCCCGCCGCAGGCTGCGCCTCCAGGACCTGGCGGACCGTGTGGTGGACGCCTCTGAGGATGAGCACG
AA
CTGAACCAGCTGCTTAATGAGGCCCTGCTGGAGCGGGAGTCCGCCCAGGTGGTAAAGAAGAGAAACAC
A
TTCCTCCTGACCATGAGGTTCATGGACCCAGAGATGGAAACACGCTACTCGGTGGAGAAGGAGAAGCAG
AGC
GGGGCTGCCTTCAGCTGCTCCTGTGTGGTCCTCTTCTGCACGGCCATGGTGGAGATACTCATTGACC
CC
TGGCTGATGACAAACTATGTGACCTTTGTGGTTGGGGAGGTTCTGCTCCTGATCCTGACCATCTGCTC
G
ATGGCTGCCATCTTTCCCAGGTCATTTCCCAAGAAGCTTGTGGCCTTCTCATCTTGGATTGACCGGACC
CGC
TGGGCAAGGAACACCTGGGCCATGTTAGCCATCTTCATTCTGGTTATGGCCAATGTTGTGGACATGC
TC
AGCTGTCTCCAGTACTACATGGGACCTTACAACATGACAGCTGGGATGGAGCTGGACGGCGGCTGCAT
G
GAGAACCCCAAGTACTACAACTACGTAGCTGTGCTGTCGCTCATCGCCACCATCATGCTGGTGCAGGTC
AGC
CACATGGTGAAGCTGACGCTCATGCTGCTCGTCACAGGCGCCGTGACTGCCCTCAACCTGTACGCCT
GG
TGTCCTGTCTTTGATGAATACGACCACAAGCGCTTTCAGGAAAAGGACTCTCCTATGGTGGCCTTAGA
G
AAGATGCAGGTACTTGCCACCCCTGGGCTCAATGGCACTGACAGGCTGCCCCTGGTGCCTTCCAAGTAC
TCC
ATGACTGTGATGATGTTCGTCATGATGCTGAGCTTTTACTACTTCTCGCGCCACGTGGAAAAACTGG
CC
CGAACACTGTTCTTGTGGAAGATTGAGGTCCATGACCAGAAAGAACGTGTCTACGAGATGCGCCGATG
G
AACGAGGCCTTGGTCACCAACATGTTGCCTGAGCATGTTGCACGCCATTTTCTGGGGTCCAAGAAGAGA
GAT
GAGGAGCTGTACAGCCAGTCTTATGACGAGATTGGAGTCATGTTTGCCTCCTTGCCCAACTTTGCTG
AC
TTCTACACTGAGGAGAGCATCAACAACGGCGGCATCGAGTGTCTACGCTTCCTCAATGAGATCATCTC
T
GATTTTGACTCTCTCCTGGACAATCCCAAATTCCGGGTCATCACCAAGATCAAAACTATTGGCAGCACC
TAT
ATGGCAGCTTCAGGAGTCACACCAGATGTCAACACCAATGGCTTTACAAGCTCCAGCAAGGAGGAGA
AG
TCAGACAAGGAGCGCTGGCAGCACCTGGCTGACCTGGCTGACTTTGCATTAGCCATGAAGGACACGCT
C
ACAAACATCAACAACCAGTCATTCAACAACTTCATGTTGCGCATAGGCATGAACAAAGGAGGGGTTCTG
GCT
GGCGTCATTGGAGCCCGGAAACCACACTATGACATCTGGGGCAATACGGTCAATGTGGCCAGCAGGA
TG
GAATCCACAGGAGTCATGGGCAACATCCAGGTGGTAGAAGAGACGCAGGTCATCCTTCGAGAGTACGG
C
TTCCGCTTTGTGAGGCGAGGTCCCATCTTTGTGAAAGGCAAAGGGGAGCTTCTGACCTTTTTCTTGAAG
GGG
CGGGACAGGCCAGCTGCCTTCCCCAATGGCTCCTCTGTTACACTGCCCCACCAAGTGGTGGACAACC
CC
TGA


Translation (1144 aa):
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYF
K
RQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVP
Y
LLWLLISAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVA
Q
QQQDELEGMQLLRE
ILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLML
S
ILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENV
SILFADIVGFTQLSSACSAQELVKLLNELFAR
F
DKLAA
KYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
L
GGVLGQKRWQYDVWSTDVTVANKMEAGGIP
GRVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETY
L
IIASKPEVKKTAQNGLNGS
AVPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFP
N
PRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQ
S
GAAFSCSCVVLFCTAMVEILIDP
WLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFSSWIDRT
R
WARNTWAMLAIFILVMANVVDM
LSCLQYYMGPYNMTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQV
S
HMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRFQEK
DSPMVALEKMQVLATPGLNGTDRLPLVPSKY
S
MTVMMFVMMLSFYYFSRH
VEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKR
D
E
ELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGST
Y
MAASGVTPDVNTNGFTSSSK
EEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVL
A
GVIGARKPHYDIWGNTVNVASRMESTGVMGNIQ
VVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLK
G
RDRPAAFPNGSSVTLPHQVVDNP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser