NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22800.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22800.1 Public Mus musculus 9 Casp12 16 104 75 CCDS HistoryNCBI Gene:12364Re-query CCDS DB by CCDS ID:22800.1Re-query CCDS DB by GeneID:12364

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22800.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027009 ENSMUSP00000027009 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027009Link to Ensembl Protein Viewer:ENSMUSP00000027009Re-query CCDS DB by Nucleotide ID:ENSMUST00000027009Re-query CCDS DB by Protein ID:ENSMUSP00000027009
Original member Current member EBI,WTSI OTTMUST00000084913 OTTMUSP00000045800 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084913Link to Vega Protein Viewer:OTTMUSP00000045800Re-query CCDS DB by Nucleotide ID:OTTMUST00000084913Re-query CCDS DB by Protein ID:OTTMUSP00000045800
Original member Current member NCBI NM_009808.4 NP_033938.3 Accepted alive Link to Nucleotide Sequence:NM_009808.4Link to Protein Sequence:NP_033938.3Re-query CCDS DB by Nucleotide ID:NM_009808Re-query CCDS DB by Protein ID:NP_033938Link to BLink:NP_033938.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033938.3 419 O08736 419 100% 0 0

Chromosomal Locations for CCDS 22800.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

Chromosome Start Stop Links
9 5345519 5345525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5346482 5346733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5348899 5348958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5350400 5350477 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5352197 5352291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5352672 5352845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5353634 5353868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5354534 5354683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5358246 5358355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 5358725 5358823 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1260 nt):
ATGGCGGCCAGGAGGACACATGAAAGAGATCCAATCTACAAGATCAAAGGTTTGGCCAAGGACATGCTGG
AT
GGGGTTTTTGATGACCTGGTGGAGAAGAATGTTTTAAATGGAGATGAGTTACTCAAAATAGGGGAAAG
T
GCGAGTTTCATCCTGAACAAGGCTGAGAATCTGGTTGAGAACTTCTTAGAGAAAACAGACATGGCAGGA
AAA
ATATTTGCTGGCCACATTGCCAATTCCCAGGAACAGCTGAGTTTACAATTTTCTAATGATGAGGATG
AT
GGACCTCAGAAGATATGTACACCTTCTTCTCCATCAGAATCCAAGAGAAAAGTAGAGGATGATGAAAT
G
GAGGTAAATGCTGGATTGGCCCATGAATCACATCTAATGCTGACAGCTCCTCATGGACTCCAGAGCTCA
GAA
GTCCAAGATACACTGAAGCTTTGTCCACGTGATCAGTTTTGTAAGATAAAGACAGAAAGGGCAAAAG
AG
ATATATCCAGTGATGGAGAAGGAGGGACGAACACGTCTGGCTCTCATCATCTGCAACAAAAAGTTTGA
C
TACCTTTTTGATAGAGATAATGCTGATACTGACATTTTGAACATGCAAGAACTACTTGAAAATCTTGGA
TAC
TCTGTGGTGTTAAAGGAAAACCTTACAGCTCAGGAAATGGAGACAGAGTTAATGCAGTTTGCTGGCC
GT
CCAGAGCACCAGTCCTCAGACAGCACATTCCTGGTGTTTATGTCCCATGGCATCCTGGAAGGAATCTG
T
GGGGTGAAGCACCGAAACAAAAAGCCAGATGTTCTTCATGATGACACTATCTTCAAAATTTTCAACAAC
TCT
AACTGTCGGAGTCTGAGAAACAAACCCAAGATTCTCATCATGCAGGCCTGCAGAGGCAGATATAATG
GA
ACTATTTGGGTATCCACAAACAAAGGGATAGCCACTGCTGATACAGATGAGGAACGTGTGTTGAGCTG
T
AAATGGAATAATAGTATAACAAAGGCCCATGTGGAGACAGATTTCATTGCTTTCAAATCTTCTACCCCA
C
AT
AATATTTCTTGGAAGGTAGGCAAGACTGGTTCCCTCTTCATTTCCAAACTCATTGACTGCTTCAAAA
AG
TACTGTTGGTGTTATCATTTGGAGGAAATTTTTCGAAAGGTTCAACACTCATTTGAGGTCCCAGGTGA
A
CTGACCCAGATGCCCACTATTGAGAGAGTATCCATGACACGCTATTTCTACCTTTTTCCCGGGAATTAG


Translation (419 aa):
MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAG
K
IFAGHIANSQEQLSL
QFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSS
E
VQDTLKLCPRDQFCKIKTERAKE
IYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLG
Y
SVVLKENLTAQ
EMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNN
S
NCRSLRNKPKILIMQACRG
RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIAFKSSTP
H
NISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSMTRYFYLFPGN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser