NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19093.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19093.1 Public Mus musculus 5 Sema3e 16 104 75 CCDS HistoryNCBI Gene:20349Re-query CCDS DB by CCDS ID:19093.1Re-query CCDS DB by GeneID:20349See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19093.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073957 ENSMUSP00000073612 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073957Link to Ensembl Protein Viewer:ENSMUSP00000073612Re-query CCDS DB by Nucleotide ID:ENSMUST00000073957Re-query CCDS DB by Protein ID:ENSMUSP00000073612
Original member Current member EBI,WTSI OTTMUST00000073649 OTTMUSP00000038158 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000073649Link to Vega Protein Viewer:OTTMUSP00000038158Re-query CCDS DB by Nucleotide ID:OTTMUST00000073649Re-query CCDS DB by Protein ID:OTTMUSP00000038158
Original member Current member NCBI NM_011348.2 NP_035478.2 Accepted alive Link to Nucleotide Sequence:NM_011348.2Link to Protein Sequence:NP_035478.2Re-query CCDS DB by Nucleotide ID:NM_011348Re-query CCDS DB by Protein ID:NP_035478Link to BLink:NP_035478.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035478.2 775 P70275 775 100% 0 0

Chromosomal Locations for CCDS 19093.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 14025910 14026024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14143874 14144034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14162188 14162247 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14164059 14164178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14210291 14210384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14224287 14224406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14225553 14225695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14226416 14226530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14226635 14226704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14230107 14230251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14231995 14232217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14233625 14233716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14236042 14236083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14236267 14236433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14240570 14240637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14240963 14241102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 14252338 14252790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2328 nt):
ATGGCACCGGCCGGACACATCCTCACCTTGCTGCTCTGGGGTCACCTGCTGGAACTCTGGACCCCAGGTC
AC
TCCGCGAACCCCTCCTACCCCAGGCTACGCCTGTCACATAAAGAACTTTTGGAACTGAATAGGACTTC
A
ATATTTCAAAGCCCCCTTGGATTTCTTGATCTCCATACAATGCTGCTGGATGAGTATCAAGAACGGCTC
TTT
GTGGGAGGCAGAGACCTTGTCTATTCCCTGAACTTGGAACGAGTCAGTGACGGCTACAGAGAGATAT
AC
TGGCCGAGCACAGCAGTAAAGGTAGAAGAATGCATAATGAAAGGAAAAGACGCAAATGAGTGTGCCAA
T
TATATCCGGGTTTTGCATCACTACAACAGGACACACCTTCTGACCTGTGCTACTGGAGCTTTTGATCCA
CAC
TGTGCCTTCATCAGAGTCGGGCACCATTCAGAGGAACCCCTGTTTCACCTGGAGTCACACAGATCTG
AG
AGAGGAAGGGGCAGATGTCCTTTTGACCCCAACTCCTCCTTTGTGTCCACGCTAGTTGGGAATGAGCT
G
TTTGCTGGACTCTACAGTGACTATTGGGGCAGAGACTCGGCGATCTTCCGCAGCATGGGGAAGTTAGGC
CAT
ATTCGCACTGAGCATGACGATGAGCGGCTCCTGAAAGAACCAAAATTTGTAGGTTCATATATGATTC
CT
GATAACGAAGACCGAGATGACAACAAAATGTACTTTTTCTTTACTGAGAAGGCGCTGGAGGCGGAGAA
C
AACGCCCACACGATCTACACCCGAGTGGGGCGGCTGTGCGTGAATGACATGGGAGGACAGAGAATCCTG
GTG
AACAAGTGGAGCACTTTCCTTAAAGCGCGGCTGGTTTGCTCAGTGCCGGGAATGAATGGAATCGACA
CA
TACTTTGACGAACTAGAGGATGTGTTTTTACTGCCGACCAGAGATCCTAAGAATCCAGTGATATTTGG
A
CTGTTTAATACTACCAGCAATATATTTAGAGGCCATGCTGTATGTGTGTATCACATGTCAAGTATCCGG
GAA
GCCTTTAATGGCCCATATGCTCATAAAGAAGGCCCTGAATACCACTGGTCACTATATGAAGGAAAAG
TC
CCCTACCCAAGGCCTGGTTCCTGTGCCAGCAAAGTAAACGGAGGCAAGTATGGAACCACCAAAGATTA
C
CCCGATGACGCCATCCGGTTCGCAAGGATGCATCCTCTAATGTATCAGCCCATAAAACCTGTTCATAAA
AAA
CCAATACTGGTAAAAACAGATGGAAAATACAACCTGAGGCAACTTGCCGTGGATCGGGTGGAAGCGG
AG
GATGGCCAGTATGACGTCTTATTTATTGGGACAGACACAGGAATTGTGCTGAAAGTAATCACAATTTA
C
AACCAAGAAACAGAGTGGATGGAGGAAGTCATTCTAGAGGAACTTCAAATATTCAAGGATCCAGCCCCT
ATC
ATTTCTATGGAAATTTCTTCAAAGAGACAACAGCTTTACATTGGATCAGCCTCTGCTGTGGCACAAG
TC
AGATTCCATCACTGCGACATGTATGGCAGTGCTTGTGCTGACTGCTGCCTGGCTCGAGACCCGTACTG
T
GCCTGGGATGGCATATCCTGCTCCAGGTACTACCCAACAGGTGCACACGCAAAGAGGAGGTTCCGCAGG
CAG
GACGTTCGGCATGGCAACGCCGCCCAACAGTGCTTTGGACAGCAATTTGTTGGAGACGCGTTGGACA
GG
ACTGAAGAGAGGCTGGCTTATGGCATAGAGAGCAACAGTACTCTGTTGGAATGCACCCCGCGATCACT
A
CAAGCAAAAGTCATCTGGTTTGTACAGAAGGGACGCGACGTAAGAAAAGAAGAGGTGAAGACGGATGAC
AGA
GTTGTCAAGATGGACTTGGGCTTGCTCTTCCTCAGAGTACGCAAGTCAGATGCAGGGACCTATTTTT
GC
CAGACAGTAGAACACAATTTTGTCCATACTGTGCGTAAAATCACCTTGGAGGTGGTCGAAGAGCATAA
A
GTGGAGGGCATGTTTCATAAGGACCATGAAGAGGAAAGACATCACAAGATGCCCTGCCCTCCCTTAAGC
GGT
ATGTCTCAGGGGACAAAACCGTGGTACAAGGAATTCTTGCAGCTGATTGGCTACAGCAACTTCCAGA
GA
GTGGAAGAATACTGCGAAAAGGTGTGGTGTACAGATAAGAAGAGGAAAAAGCTTAAAATGTCTCCCTC
C
AAGTGGAAGTATGCCAACCCCCAGGAAAAGAGGCTTCGCTCTAAAGCTGAGCACTTCCGCCTGCCCAGG
CAC
ACGCTGCTCTCCTGA


Translation (775 aa):
MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNRTSIFQSPLGFLDLHTMLLDEYQERL
F
VGGRDLVYSLNLERVSDGYRE
IYWPSTAVKVEECIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDP
H
CAFIRVGHHSE
EPLFHLESHRSERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLG
H
IRTEHDDERLLK
EPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRIL
V
NKWSTFLKARLVCSVPGMNGIDTYFDEL
EDVFLLPTRDPKNPVIFGLFNTTSNIFRGHAVCVYHMSSIR
E
AFNGPYAHKEGPEYHWSLYEGKVPYPRPGS
CASKVNGGKYGTTKDYPDDAIRFARMHPLMYQPIKPVHK
K
PILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGT
DTGIVLKVITIYNQETEWMEEVILEELQIFKDPAP
I
ISMEISSKR
QQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRR
Q
DVRHGNAAQQCFGQQFV
GDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDD
R
VVKMDLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKMPCPPLS
G
MSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYANPQEKRLRSKAEHFRLPR
H
TLLS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser