NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26911.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26911.1 Public Mus musculus 14 Capn7 16 104 75 CCDS HistoryNCBI Gene:12339Re-query CCDS DB by CCDS ID:26911.1Re-query CCDS DB by GeneID:12339See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26911.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022451 ENSMUSP00000022451 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022451Link to Ensembl Protein Viewer:ENSMUSP00000022451Re-query CCDS DB by Nucleotide ID:ENSMUST00000022451Re-query CCDS DB by Protein ID:ENSMUSP00000022451
Original member Current member EBI,WTSI OTTMUST00000069127 OTTMUSP00000035062 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000069127Link to Vega Protein Viewer:OTTMUSP00000035062Re-query CCDS DB by Nucleotide ID:OTTMUST00000069127Re-query CCDS DB by Protein ID:OTTMUSP00000035062
Original member Current member NCBI NM_009796.2 NP_033926.1 Accepted alive Link to Nucleotide Sequence:NM_009796.2Link to Protein Sequence:NP_033926.1Re-query CCDS DB by Nucleotide ID:NM_009796Re-query CCDS DB by Protein ID:NP_033926Link to BLink:NP_033926.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033926.1 813 Q9R1S8 813 100% 0 0

Chromosomal Locations for CCDS 26911.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 31336882 31336983 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31340035 31340143 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31344442 31344599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31345459 31345526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31347658 31347858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31349799 31349885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31352367 31352493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31354095 31354180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31355265 31355358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31358606 31358752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31359207 31359313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31360125 31360245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31363479 31363623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31364448 31364547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31365456 31365591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31366168 31366243 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31368056 31368201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31369198 31369260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31369721 31369851 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31370702 31370794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 31370878 31371022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2442 nt):
ATGGACGCGTCGGCGCTGGAGCGGGACGCCGTGCAGTTCGCGCGGCTGGCAGTGCAGCGCGACCACGAAG
GC
CGCTACTCTGAGGCGGTGTTTTACTACAAGGAAGCTGCCCAAGCTTTAATTTATGCTGAGATGGCAGG
A
TCCAGCCTAGAAAGGATCCAAGAGAAGATCAATGAGTATCTGGAAAGAGTGCAAGCCCTTCACTCTGCA
G
TT
CAGTCAAAGAGTACTGATCCTTTGAAATCAAAACACCAGTTGGATCTAGAACGTGCCCATTTTCTTG
TT
ACACAAGCTTTCGATGAAGATGAAAAGGGGAATGTGGAAGATGCCATAGAATTATATACAGAAGCTGT
G
GAACTCTGTCTAAAAACCTCTTCTGAAACTGCTGACAAGACTCTGCAAAATAAATTGAAACAGTTGGCT
CGA
CAGGCACTAGATAGAGCAGAAGCATTGAGTGAACCTTTGACAAAGCCATTTTGCAAACTCAAGTCAG
CA
AATATGAAAACAAAGACTCCTCCAGTAAGAACACACTTTCCTCTAGGACCTAATCCTTTCGTTGAAAA
G
CCTCAAGCATTTATAAGTCCACAGTCATGTGATGCGCAAGGACAGAAGTACACAGCAGAAGAGATAGAA
GTG
CTCAGGACAACATCAAAAATAAATGGTGTAGAATATGTTCCTTTCATGAGTGTTGATCTAAGGGAAC
GC
TTTGCTTATCCAATGCCTTTTTGTGATAGGTTGGGCAAGCTTCCATTATCACCTAAACAAAAAACTAC
A
TTTTCTAAATGGGTACGACCGGAAGATCTCACCAACAATCCTACAATGATATACACTGTGTCCAGTTTT
AGC
ATAAAGCAGACAATAGTATCAGATTGTTCCTTTGTGGCATCGTTGGCTATCAGTGCAGCGTATGAGA
GA
CGATTCAATAAGAAGTTAATTACCAGCATAATTTACCCCCAGAATAAGGATGGAGAACCAGAGTACAA
T
CCCTGTGGAAAGTATATGGTAAAGCTTCACCTCAATGGTGTTCCGAGAAAGGTGATAATTGATGACCAG
TTA
CCTGTTGATCACAAAGGAGAATTGCTGTGTTCTTATTCCAACAATAAAAGTGAATTGTGGGTGTCAC
TT
ATAGAGAAAGCATACATGAAAGTTATGGGAGGATATGATTTCCCAGGATCCAACTCAAATATTGATCT
G
CATGCACTGACTGGGTGGATACCAGAAAGGATTGCCATGCATTCAGATAGCCAGACGTTCAGTAAGGAT
AAC
TCATTCAGAATGCTTTATCAAAGATTTCACAAAGGAGATGTCCTCATCACCGCATCGACGGGAGTAA
TG
ACTGAAGCTGAAGGGGAGAAGTGGGGCCTGGTTCCCACTCATGCCTATGCGGTTTTGGATATTAGAGA
G
TTCAAGGGGCTGAGATTTATTCAGTTAAAAAACCCTTGGAGCCATTTACGCTGGAAAGGAAGGTACAGT
GAG
AATGATGTGAAAAACTGGACCCCAGAATTGCAGAAGTATTTAAACTTTGATCCACGAACAGCTCAGA
AA
ATAGATAATGGAATATTTTGGATTTCCTGGGATGATCTTTGCCAGTATTATGATGTAGTTTATTTGAG
T
TGGAATCCAGCTCTTTTTAAAGAATCAACTTGCATTCACAGTACTTGGGATGCTAAACAAGGACCTGTG
AAA
GATGCTTATAGCCTGGCCAACAACCCCCAGTACAAATTGGAGGTGCAGTGTCCACAAGGGGGTGCTG
CA
GTTTGGGTTTTGCTTAGTAGACACATAACAGACAAGGATGACTTCGCAAATAACCGTGAGTTTATCAC
A
ATGGTTGTGTACAAGACTGATGGCAAGAAGGTTTACTACCCAGCTGACCCACCTCCATACATTGATGGG
ATT
CGAATTAACAGCCCTCATTACTTGACTAAGATAAAGCTGACCACGCCCGGGACTCACACCTTCACCC
TA
GTGGTTTCTCAGTATGAGAAACAGAATACGATTCATTACACAGTCCGGGTGTATTCAGCCTGCAGCTT
T
ACTTTTTCGAAGATCCCTTCACCATACACCTTATCCAAACGGATAAATGGAAAGTGGAGTGGTCAAAGT
GCT
GGAGGATGTGGAAATTTTCAGGAGACTCACAAAAATAACCCCATCTACCAATTCCATATAGATAAGA
CT
GGACCGTTATTGATTGAGCTGAGAGGACCAAGGCAATACAGTGTTGGATTTGAGGTTGTAGCAGTTTC
C
ATAATGGGAGATCCTGGTCCTCATGGCTTTCAGAGGAAATCTAGTGGTGACTATAGGTGTGGATTTTGC
TAC
TTAGAACTGGAAAACATACCTGCTGGGATCTTTAATATCATCCCTAGTACTTTTTTGCCTAAACAAG
AA
GGACCTTTTTTCTTGGACTTTAATAGTACTGTCCCCATCAAGACAACACAACTCCAATGA


Translation (813 aa):
MDASALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLERIQEKINEYLERVQALHSA
V
QSKSTDPLKSKHQLDLERAHFLVTQAFDEDEKGNVEDAIELYTEAVELCLKTSSETADKTLQNKLKQLA
R
QALD
RAEALSEPLTKPFCKLKSANMKTKTPPVRTHFPLGPNPFVEKPQAFISPQSCDAQGQKYTAEEIE
V
L
RTTSKINGVEYVPFMSVDLRERFAYPMPFCDRLGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSF
S
IKQ
TIVSDCSFVASLAISAAYERRFNKKLITSIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQ
L
PVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNS
NIDLHALTGWIPERIAMHSDSQTFSKD
N
SFRMLYQ
RFHKGDVLITASTGVMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYS
E
NDVKNWTPELQKYLNFDPRTAQKIDN
GIFWISWDDLCQYYDVVYLSWNPALFKESTCIHSTWDAKQGPV
K
DAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDK
DDFANNREFITMVVYKTDGKKVYYPADPPPYIDG
I
RINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVR
VYSACSFTFSKIPSPYTLSKRINGKWSGQS
A
GGCGNFQETHKNNPIYQFHIDKTGPLLIELRGP
RQYSVGFEVVAVSIMGDPGPHGFQRKSSGDYRCGFC
Y
LELENIPAGIFNIIPSTFLPKQEGPFFLDFNSTVPIKTTQLQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser