NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37317.1 Public Mus musculus 16 Slc12a8 16 104 75 CCDS HistoryNCBI Gene:171286Re-query CCDS DB by CCDS ID:37317.1Re-query CCDS DB by GeneID:171286

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37317.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000119173 ENSMUSP00000113633 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119173Link to Ensembl Protein Viewer:ENSMUSP00000113633Re-query CCDS DB by Nucleotide ID:ENSMUST00000119173Re-query CCDS DB by Protein ID:ENSMUSP00000113633
Original member Current member EBI,WTSI OTTMUST00000067508 OTTMUSP00000033982 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067508Link to Vega Protein Viewer:OTTMUSP00000033982Re-query CCDS DB by Nucleotide ID:OTTMUST00000067508Re-query CCDS DB by Protein ID:OTTMUSP00000033982
Original member Current member NCBI NM_001083902.1 NP_001077371.1 Accepted alive Link to Nucleotide Sequence:NM_001083902.1Link to Protein Sequence:NP_001077371.1Re-query CCDS DB by Nucleotide ID:NM_001083902Re-query CCDS DB by Protein ID:NP_001077371Link to BLink:NP_001077371.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001077371.1 625 Q8VI23-3 625 100% 0 0

Chromosomal Locations for CCDS 37317.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 33534909 33535010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33540852 33541043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33550883 33551114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33590252 33590365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33606166 33606253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33608145 33608232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33624554 33625175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33646563 33646660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33649818 33649935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33658197 33658257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33662925 33663087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1878 nt):
ATGTGGGAGCCGGTGCTGTTTGGGACCTGGGATGGTGTGTTCACATCCTGCATGATCAACATTTTTGGCG
TT
GTCCTTTTCTTGAGGACCGGCTGGCTGGTGGGAAACACAGGTGTGCTCCTGGGCTTGCTCCTGGTGTC
C
TTCGTCGTCCTCGTGGCCCTCATCACCGTGCTGTCGGGCATTGGTGTCGCAGAGCATGGCGGGATCAGC
AGT
GGCGGTGTCTACTCCATGATCTCCTCGGTGCTTGGTGGGCAGATGGGAGGCACTGTGGGGCTGCTCT
AT
GTATTTGGACAGTGTGTTGCAGGTGCTATGTACATCACCGGCTTTGCGGAGTCCATCTCAGATCTGCT
G
GGACTTGGGGACATCTGGGCAGTGCGTGGAATTTCAGTTGCTGTGCTTCTGGCTTTGCTGGGCATCAAC
CTG
GCAGGTGTCAAGTGGATTATCCGCCTCCAGCTGCTGCTGCTGCTCCTGCTGGCTGTCTCGACCCTGG
AC
TTTGTGGTGGGCTCTTTCACCCACCTGGACCCAGAACATGGCTTTATTGGCTACTCCCCAGAACTGCT
A
CAGAGCAACATTCTGCCAGAGTACAGCCCCGGGGAGTCATTCTTCACTGTGTTTGGGGTGTTCTTCCCT
GCA
GCTACAGGAGTCATGGCTGGCTTCAACATGGGAGGAGACCTGAGAGACCCTGCTGACAGTGTCCCCT
TA
GGCTCCCTAGCAGCTGTTGGCGTCTCGTGGTTTCTCTACATCATCTTTGCCTTCCTGCTTGGTGCCGT
C
TGTACCCGAGAGGCCCTCCGCTCTGACTTCCTGATAGCTGAAAAGAAAGGGCCAAATAAAACACCGGTA
GCA
GCCATCTGCCTGACCAGCTTGGTGACCATGGCCTTTGTCCTGGTGGGTCAGGTGAATGTTCTGGCGC
CC
GTTGTCACCATCAATTTCATGCTGACCTACATCATGGTGGACTACTCTTACTTCGCCCTCTCCATGGC
T
CACTGTGGCCTCGCCCCATCTCCTGAGCCCGTCCCCAGACAAGGCCCAGATACTCTGCACTGCTCTGAG
CAC
CTGCTCCAGGACAGGGCTCCCAGCTACGGCTCTGATGTCCCTGCCAGAAGCCTCTCTGAGGGCACCC
TG
CTGGAGTTCACCAAGGACATGGATCAGTTCCTCCAGCCAATAGAGGAACTGGAGAGTCGTCAGCTTGG
G
TCAAGAGAAGGAAACAACCCAAAGAATCAGAAGCGCAAGGGTAAGAAAGGCGCCAAGCAAACCCTACAA
GAT
AGCTTCCTCTTGGACCCTGGGTCTCCTTTGTCCTTTCCTACGAGGACTTCTGAGAGGTTGTCTGTTG
CC
TTCTGTGGGGAGCAAGAGTCCTATCAGAAGCAGCAGACTTCTAGGAGTGAATCACATGACCATCTTGT
T
CCTGATCTACGCAACCAGCCTAGAGTGAACAGAGAAGATTTCTTTCTGAAATGCAGACTTCAGGAACAA
GAG
ATCCAGAGAAGACCAAGTGTTTTCTATGCTTGCATGTGTAACCCCTGGGTCTCCCTGTTAGGGGCTC
TT
GCATCCCTGCTCATCATGTTTGTGATCCAGTGGCTCTATACCCTAGCTAGTATGGGTGTTGCTGCCCT
T
GTGTATTTCTACATTGGCCAGGCAAGTCCAGGCCTTTACCTCGGATCAGCATCAAACTTCAGCTTTTTC
CAA
TGGATGAAGTCCTTCTTGGTCCCCTCCTGCAGGAGCCTGAGGTCCGCCCAGGAGCAAATCATCTTGG
CG
CCATCACCAGCCAAGGTTGACATGGCAATGACTCAGCTTACCCAGGACAATGCAGACTTCGCCACCCG
A
GATCGTTACCACCACTCCTCCTTCCTGAGCCGGGAGCAGTTGATGCCTCCCTACTAG


Translation (625 aa):
MWEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVVLVALITVLSGIGVAEHGGIS
S
GGVYSMISSVLGGQMGGTVGLLYVFGQ
CVAGAMYITGFAESISDLLGLGDIWAVRGISVAVLLALLGIN
L
AGVKWIIRLQLLLLLLLAVSTLDFVVGSFTHLDP
EHGFIGYSPELLQSNILPEYSPGESFFTVFGVFFP
A
AT
GVMAGFNMGGDLRDPADSVPLGSLAAVGVSWFLYIIFAFLLGAVCTREALRSDFLIAEKKGPNKTPV
A
AICLTSLVTMAFVLVGQVNVLAPVVTINFMLTYIMVDYSYFALSMAHCGLAPSPEPVPRQGPDTLHCSE
H
LLQDRAPSYGSDVPARSLSEGTLLEFTKDMDQFLQPIEELESRQLGSREGNNPKNQKRKGKKGAKQTLQ
D
SFLLDPGSPLSFPTRTSERLSVAFCGEQESYQKQQTSRSESHDHLVPDLRNQPRVNRE
DFFLKCRLQEQ
E
IQRRPSVFYACMCNPWVSLLG
ALASLLIMFVIQWLYTLASMGVAALVYFYIGQASPGLYLGSASNFSFF
Q
WMKSFLVPSC
RSLRSAQEQIILAPSPAKVDMAMTQLTQDNADFATRDRYHHSSFLSREQLMPPY



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser