NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15464.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15464.1 Public Mus musculus 1 Rgs5 16 104 75 CCDS HistoryNCBI Gene:19737Re-query CCDS DB by CCDS ID:15464.1Re-query CCDS DB by GeneID:19737

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15464.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027997 ENSMUSP00000027997 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027997Link to Ensembl Protein Viewer:ENSMUSP00000027997Re-query CCDS DB by Nucleotide ID:ENSMUST00000027997Re-query CCDS DB by Protein ID:ENSMUSP00000027997
Original member Current member EBI,WTSI OTTMUST00000049406 OTTMUSP00000022882 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049406Link to Vega Protein Viewer:OTTMUSP00000022882Re-query CCDS DB by Nucleotide ID:OTTMUST00000049406Re-query CCDS DB by Protein ID:OTTMUSP00000022882
Original member Current member NCBI NM_009063.3 NP_033089.2 Accepted alive Link to Nucleotide Sequence:NM_009063.3Link to Protein Sequence:NP_033089.2Re-query CCDS DB by Nucleotide ID:NM_009063Re-query CCDS DB by Protein ID:NP_033089Link to BLink:NP_033089.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033089.2 181 O08850 181 100% 0 0

Chromosomal Locations for CCDS 15464.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 169655578 169655621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 169676827 169676937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 169682755 169682816 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 169690416 169690582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 169692179 169692340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (546 nt):
ATGTGTAAGGGACTGGCAGCTCTGCCGCACTCATGCCTGGAAAGGGCCAAGGAGATCAAGATCAAGTTGG
GA
ATTCTCCTCCAGAAGCCAGACTCTGCTGTTGACCTTGTCATTCCATACAATGAGAAGCCAGAGAAGCC
T
GCCAAGGCACACAAGCCCTCACTGGAGGAGGTCCTGCAGTGGCGCCAGTCCCTGGACAAGCTTCTCCAG
AAC
AGCTATGGATTTGCCAGCTTCAAAAGTTTCCTGAAGTCTGAATTCAGTGAGGAAAACCTTGAGTTCT
GG
GTTGCCTGTGAGAATTACAAGAAGATCAAGTCCCCCATCAAAATGGCGGAGAAGGCAAAGCAAATTTA
T
GAAGAATTCATCCAGACAGAGGCCCCTAAAGAGGTGAACATTGACCACTTCACTAAAGACATCACCATG
AAG
AACCTGGTGGAACCGTCTCCTCGCAGCTTTGACTTGGCCCAGAAAAGGATCTATGCCCTGATGGAGA
AG
GATTCTCTGCCCCGCTTTGTGCGCTCTGAATTTTATAAGGAGCTAATCAAGTAG


Translation (181 aa):
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAHKPSLEEVLQWRQSLDKLLQ
N
S
YGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM
K
NLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKELIK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser