NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52454.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52454.1 Public Mus musculus 7 Tnnt3 19 105 81 CCDS HistoryNCBI Gene:21957Re-query CCDS DB by CCDS ID:52454.1Re-query CCDS DB by GeneID:21957See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 52454.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078497 ENSMUSP00000077587 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078497Link to Ensembl Protein Viewer:ENSMUSP00000077587Re-query CCDS DB by Nucleotide ID:ENSMUST00000078497Re-query CCDS DB by Protein ID:ENSMUSP00000077587
Original member Current member EBI,WTSI OTTMUST00000045209 OTTMUSP00000020324 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045209Link to Vega Protein Viewer:OTTMUSP00000020324Re-query CCDS DB by Nucleotide ID:OTTMUST00000045209Re-query CCDS DB by Protein ID:OTTMUSP00000020324
Original member Current member NCBI NM_001163667.1 NP_001157139.1 Accepted alive Link to Nucleotide Sequence:NM_001163667.1Link to Protein Sequence:NP_001157139.1Re-query CCDS DB by Nucleotide ID:NM_001163667Re-query CCDS DB by Protein ID:NP_001157139Link to BLink:NP_001157139.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157139.1 268 Q9QZ47-2 268 99.6269% 0 1

Chromosomal Locations for CCDS 52454.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 142501638 142501654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142501829 142501842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142502740 142502757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142504048 142504065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142504250 142504264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142505516 142505530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142507750 142507788 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142508335 142508353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142510664 142510709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142511257 142511373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142511465 142511542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142512036 142512149 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142512256 142512365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142512532 142512622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142514326 142514366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 142515776 142515830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (807 nt):
ATGTCTGACGAGGAAACTGAACAAGTTGAGGAACAATACGAAGAGGAAGAGGAGGCCCAAGAGGAAGAAG
TC
CAGGAGGAAGAGGAAGTCCAAGAAGATGCTGTCGCCGAGGAGGAGCGGGAGGAGGACGAGGAAGAGGA
G
AAACCAAGACCCAAACTTACTGCTCCTAAGATCCCGGAAGGGGAGAAAGTAGACTTTGATGACATCCAG
AAG
AAGCGTCAAAACAAGGACCTCATGGAGCTCCAAGCCCTCATTGACAGCCACTTTGAAGCTAGAAAGA
AA
GAAGAAGAGGAGCTAATCGCACTTAAAGAAAGAATTGAGAAGCGCCGTGCAGAGAGGGCTGAGCAGCA
A
AGAATTCGCGCTGAGAAGGAGCGGGAACGCCAGAACAGATTGGCGGAGGAGAAGGCCAGAAGAGAGGAG
GAG
GATGCCAAGAGGAGAGCTGAAGATGACATGAAGAAGAAAAAGGCTCTGTCCTCCATGGGTGCCAACT
AC
AGCAGCTACCTGGCCAAGGCTGACCAGAAGAGAGGCAAGAAACAGACAGCCCGGGAAATGAAAAAGAA
G
ATTCTTGCCGAAAGGCGCAAGCCTCTGAACATTGACCATCTTAGCGATGACAAGCTGAGGGACAAGGCC
AAG
GAACTCTGGGATACCTTGTACCAACTGGAGACTGACAAATTCGAGTTTGGGGAGAAGCTGAAACGTC
AG
AAATATGATATCACCACCCTCAGGAGCCGCATTGACCAAGCCCAGAAGCACAGCAAGAAGGCCGGTGC
C
ACAGCCAAGGGCAAAGTCGGTGGGCGCTGGAAGTAA


Translation (268 aa):
MSDEETEQVEEQYEEEEEAQEEEVQEEEEVQEDAVAEEEREEDEEEEKPRPKLTAPKIPEGEKVDFDDIQ
K
KRQNKDLMELQALIDSHFEARKKEEEELIALKERI
EKRRAERAEQQRIRAEKERERQNRLAEEKARREE
E
DAKRRAEDDMKKKKALSSMGANYSSYLAK
ADQKRGKKQTAREMKKKILAERRKPLNIDHLSDDKLRDKA
K
ELWDTLYQLETDKFEFGEKLKRQKYD
ITTLRSRIDQAQKHSKKAGATAKGKVGGRWK



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser