NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15695.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15695.1 Public Mus musculus 2 Trdmt1 16 104 75 CCDS HistoryNCBI Gene:13434Re-query CCDS DB by CCDS ID:15695.1Re-query CCDS DB by GeneID:13434See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15695.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000124488 ENSMUSP00000114572 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000124488Link to Ensembl Protein Viewer:ENSMUSP00000114572Re-query CCDS DB by Nucleotide ID:ENSMUST00000124488Re-query CCDS DB by Protein ID:ENSMUSP00000114572
Original member Current member EBI,WTSI OTTMUST00000026356 OTTMUSP00000012054 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000026356Link to Vega Protein Viewer:OTTMUSP00000012054Re-query CCDS DB by Nucleotide ID:OTTMUST00000026356Re-query CCDS DB by Protein ID:OTTMUSP00000012054
Original member Current member NCBI NM_010067.4 NP_034197.3 Accepted alive Link to Nucleotide Sequence:NM_010067.4Link to Protein Sequence:NP_034197.3Re-query CCDS DB by Nucleotide ID:NM_010067Re-query CCDS DB by Protein ID:NP_034197Link to BLink:NP_034197.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034197.3 415 O55055 415 100% 0 0

Chromosomal Locations for CCDS 15695.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 13511518 13511690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13516015 13516144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13516659 13516716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13519756 13520099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13521263 13521346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13522078 13522147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13522824 13522889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13523426 13523497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13525618 13525694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13533384 13533493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 13544569 13544632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1248 nt):
ATGGAACCTCTGCGTGTCCTGGAGCTGTACAGTGGCATTGGTGGCATGCACCACGCGCTGCGAGAAAGTC
AT
ATCCCTGCACATGTGGTGGCTGCTATTGATGTGAATACTGTTGCTAATGAAGTATACAAGCATAATTT
T
CCTCATACTCACTTACTGTCAAAGACAATTGAAGGTATTTCACTGGAAGACTTTGACAAGCTATCTTTC
AAT
ATGATTTTAATGAGCCCTCCATGCCAGCCATTCACAAGAATTGGCCTACAGGGGGATATGACCGATC
CA
AGGACAACTAGCTTCTTGTATATTCTAGATATTCTCCCAAGATTACAAAAATTACCCAAGTATATTCT
C
TTAGAAAATGTCAAAGGTTTTGAAGTATCTTCTACAAGAGGGCTGCTGATACAAACAATAGAAGCCTGT
GGC
TTTCAGTATCAAGAGTTTCTATTGTCTCCTTCTTCTCTAGGCATTCCAAACTCGAGGCTCCGATATT
TT
CTCATTGCAAAGCTTCAGTCAGAGCCTTTCCCCTTCCAGGCCCCTGGACAGATACTGATGGAGTTTCC
T
AAAATTGTAACTGTTGAGCCACAAAAATATGCAGTAGTTGAAGAAAGTCAGCCAAGAGTGCAGAGAACT
GGA
CCACGTATCTGTGCTGAGAGCAGCAGCACACAGAGTTCTGGAAAAGATACCATTCTCTTTAAGCTTG
AG
ACTGTAGAAGAAAGGGACAGGAAACATCAACAAGACAGTGACCTCTCTGTGCAGATGCTGAAAGACTT
C
CTTGAAGATGGCGACACAGATGAGTACCTTTTACCACCCAAGTTATTGCTGCGATACGCTCTCTTACTA
GAT
ATCGTGAAGCCCACGTCCAGAAGGTCCATGTGCTTTACGAAAGGGTATGGGAGTTACATAGAGGGGA
CA
GGCTCCGTGTTACAGGCTGCAGAGGATGCGCAGATTGAGAATATCTACAAATCTCTTCCTGATTTGCC
A
CCAGAAGAAAAGATAGCTAAATTGTCAATGCTTAAACTGCGATATTTCACACCGAAAGAAATTGCAAAT
CTC
CAGGGATTTCCTCCAGAATTTGGGTTTCCTGAGAAGACAACAGTGAAACAGCGTTACCGGCTGCTTG
GC
AATAGCCTCAACGTGCATGTGGTAGCAAAACTCCTCACAGTCCTGTGTGAAGGATTTGGAAATGCCTC
T
GAGAGCTGTCACAAGATGCCGCTAATTCTAGATAGTAATTCCAAGATTCTATCTTGA


Translation (415 aa):
MEPLRVLELYSGIGGMHHALRESHIPAHVVAAIDVNTVANEVYKHNFPHTHLLSKTIEGISLEDFDKLSF
N
MILMSPPCQPFT
RIGLQGDMTDPRTTSFLYILDILPRLQKLPKYILLENVKGFEVSSTRGLLIQTIEAC
G
FQYQEFLLSPSS
LGIPNSRLRYFLIAKLQSEPFPFQAPGQILMEFPKIVTVEPQKYAVVEESQPRVQRT
G
PRICAESSSTQSSGKDTILFKLETVEERDRKHQQDSDLSVQMLKDFLEDGDTDEYLLPPKLLLRYALLL
D
IVKPTSRRSMCFTK
GYGSYIEGTGSVLQAAEDAQIENIYKSLPDLPPEEKIAKLSMLKLRYFTPKEIAN
L
QGFPPEF
GFPEKTTVKQRYRLLGNSLNVHVVAKLLTVLCEGFGNASESCHKMPLILDSNSKILS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser