NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25684.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25684.1 Public Mus musculus 11 Sept9 16 104 75 CCDS HistoryNCBI Gene:53860Re-query CCDS DB by CCDS ID:25684.1Re-query CCDS DB by GeneID:53860

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25684.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000100193 ENSMUSP00000097767 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000100193Link to Ensembl Protein Viewer:ENSMUSP00000097767Re-query CCDS DB by Nucleotide ID:ENSMUST00000100193Re-query CCDS DB by Protein ID:ENSMUSP00000097767
Original member Current member EBI,WTSI ENSMUST00000106349 ENSMUSP00000101956 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106349Link to Ensembl Protein Viewer:ENSMUSP00000101956Re-query CCDS DB by Nucleotide ID:ENSMUST00000106349Re-query CCDS DB by Protein ID:ENSMUSP00000101956
Original member Current member EBI,WTSI OTTMUST00000008321 OTTMUSP00000004045 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000008321Link to Vega Protein Viewer:OTTMUSP00000004045Re-query CCDS DB by Nucleotide ID:OTTMUST00000008321Re-query CCDS DB by Protein ID:OTTMUSP00000004045
Original member Current member EBI,WTSI OTTMUST00000008322 OTTMUSP00000004046 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000008322Link to Vega Protein Viewer:OTTMUSP00000004046Re-query CCDS DB by Nucleotide ID:OTTMUST00000008322Re-query CCDS DB by Protein ID:OTTMUSP00000004046
Original member Current member NCBI NM_001113488.1 NP_001106960.1 Accepted alive Link to Nucleotide Sequence:NM_001113488.1Link to Protein Sequence:NP_001106960.1Re-query CCDS DB by Nucleotide ID:NM_001113488Re-query CCDS DB by Protein ID:NP_001106960Link to BLink:NP_001106960.1
Original member Current member NCBI NM_017380.2 NP_059076.1 Accepted alive Link to Nucleotide Sequence:NM_017380.2Link to Protein Sequence:NP_059076.1Re-query CCDS DB by Nucleotide ID:NM_017380Re-query CCDS DB by Protein ID:NP_059076Link to BLink:NP_059076.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001106960.1 334 Q80UG5-2 334 100% 0 0
NP_059076.1 334 Q80UG5-2 334 100% 0 0

Chromosomal Locations for CCDS 25684.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 117351461 117351620 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117352149 117352277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117352607 117352688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117353088 117353225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117354810 117354927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117356335 117356430 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117356613 117356709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117359419 117359470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 117360423 117360555 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1005 nt):
ATGGCTGACAACCCTAGAGATGCCATGCTCAAGCAGGCCCCCGCGTCACGGAACGAAAAGGCCCCCATGG
AG
TTCGGCTATGTGGGGATCGACTCCATCCTGGAGCAGATGCGCAGGAAGGCTATGAAACAGGGCTTCGA
G
TTTAACATCATGGTGGTTGGGCAGAGCGGCCTCGGGAAGTCCACTTTAATCAATACCCTCTTCAAGTCC
AAA
ATCAGCCGGAAGTCGGTGCAGCCCACCTCGGAGGAACGCATCCCCAAGACGATCGAAATCAAGTCGA
TC
ACCCACGATATTGAAGAGAAGGGGGTTCGAATGAAGCTGACAGTGATTGACACGCCGGGCTTCGGAGA
C
CACATCAACAATGAGAACTGCTGGCAGCCCATTATGAAGTTCATCAATGACCAATATGAGAAGTACCTG
CAG
GAGGAAGTCAACATCAACCGGAAGAAGCGCATTCCCGACACCCGTGTCCACTGCTGCCTCTACTTCA
TC
CCAGCCACCGGCCACTCGCTCAGGCCCCTGGACATTGAATTCATGAAGCGCCTAAGCAAAGTGGTGAA
C
ATTGTCCCAGTCATCGCCAAGGCTGACACGCTGACCCTGGAGGAGAGGGTCTACTTCAAACAGCGGATC
ACT
GCAGACCTGCTGTCCAACGGCATTGACGTGTACCCGCAGAAGGAGTTTGATGAGGACGCAGAAGACC
GG
CTGGTGAACGAAAAGTTCCGGGAGATGATCCCATTTGCTGTGGTGGGCAGCGACCATGAGTATCAAGT
C
AATGGCAAGAGGATTCTGGGAAGGAAGACCAAGTGGGGCACTATCGAAGTTGAGAATACCACTCACTGT
GAA
TTTGCTTACCTGCGGGATCTCCTTATCAGGACGCACATGCAAAACATCAAAGACATCACCAGCAACA
TC
CACTTCGAAGCCTACCGAGTGAAACGCCTCAACGAGGGCAACAGCGCCATGGCCAACGGGATCGAGAA
G
GAGCCGGAAGCCCAGGAGATGTAG


Translation (334 aa):
MADNPRDAMLKQAPASRNEKAPMEFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKS
K
ISRKSVQPTSEERIPKTIEIKSITH
DIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYL
Q
EEVNINRKKRIPDTRVHCCLYFIPATGH
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVYFKQRI
T
ADLLSNGIDVYPQKEFDEDAEDRLVNEKFR
EMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHC
E
FAYLRDLLI
RTHMQNIKDITSNIHFEAYRVKRLNEGNSAMANGIEKEPEAQEM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser