NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25286.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25286.1 Public Mus musculus 11 Igf2bp1 16 104 75 CCDS HistoryNCBI Gene:140486Re-query CCDS DB by CCDS ID:25286.1Re-query CCDS DB by GeneID:140486See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25286.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000013559 ENSMUSP00000013559 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000013559Link to Ensembl Protein Viewer:ENSMUSP00000013559Re-query CCDS DB by Nucleotide ID:ENSMUST00000013559Re-query CCDS DB by Protein ID:ENSMUSP00000013559
Original member Current member EBI,WTSI OTTMUST00000003877 OTTMUSP00000001867 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000003877Link to Vega Protein Viewer:OTTMUSP00000001867Re-query CCDS DB by Nucleotide ID:OTTMUST00000003877Re-query CCDS DB by Protein ID:OTTMUSP00000001867
Original member Current member NCBI NM_009951.4 NP_034081.1 Accepted alive Link to Nucleotide Sequence:NM_009951.4Link to Protein Sequence:NP_034081.1Re-query CCDS DB by Nucleotide ID:NM_009951Re-query CCDS DB by Protein ID:NP_034081Link to BLink:NP_034081.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034081.1 577 O88477 577 100% 0 0

Chromosomal Locations for CCDS 25286.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 95963500 95963592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95966177 95966290 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95966651 95966782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95967549 95967623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95968363 95968482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95968799 95968921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95969849 95969984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95970669 95970791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95973045 95973179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95973939 95974220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95975260 95975323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95979282 95979333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 95979621 95979669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 96004223 96004283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 96005459 96005633 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1734 nt):
ATGAACAAGCTTTACATCGGCAACCTCAACGAGAGTGTGACCCCCGCAGACTTGGAGAAAGTATTCGCGG
AG
CACAAGATCTCCTACAGCGGCCAGTTCTTGGTCAAATCCGGCTACGCCTTCGTGGATTGCCCCGACGA
G
CACTGGGCGATGAAGGCCATCGAAACTTTCTCGGGGAAAGTAGAACTGCAAGGAAAACGTCTAGAGATT
GAA
CACTCAGTCCCCAAAAAACAAAGGAGTCGGAAAATACAGATCCGCAATATTCCACCTCAGCTCCGAT
GG
GAAGTGCTAGATAGCCTGCTGGCTCAGTACGGTACAGTGGAGAACTGTGAGCAAGTGAACACTGAAAG
T
GAGACAGCTGTGGTCAACGTCACCTACTCTAACCGGGAGCAGACCAGGCAAGCTATCATGAAGCTAAAT
GGC
CATCAACTGGAGAACCATGCCCTGAAGGTCTCCTACATACCTGATGAGCAGATAACGCAAGGTCCTG
AG
AATGGGCGTCGTGGAGGCTTTGGGTCTCGGGGCCAGCCCCGGCAAGGGTCGCCCGTGGCAGCAGGGGC
T
CCAGCCAAGCAGCAGCCAGTGGACATCCCTCTCCGGCTCCTGGTGCCTACGCAGTATGTAGGCGCTATC
ATT
GGCAAGGAGGGTGCCACCATCCGAAACATCACAAAACAGACGCAGTCCAAAATAGACGTGCATAGGA
AG
GAGAATGCGGGCGCTGCGGAGAAGGCCATCAGCGTGCATTCAACCCCTGAAGGCTGCTCCTCCGCGTG
C
AAGATGATCTTGGAGATTATGCACAAGGAGGCAAAGGACACCAAAACGGCAGATGAAGTTCCCCTGAAG
ATC
CTGGCTCATAACAACTTCGTCGGGCGACTCATTGGCAAGGAAGGGCGGAACCTGAAGAAGGTGGAGC
AG
GACACAGAGACGAAGATCACCATCTCATCGCTCCAGGACCTCACGCTCTATAACCCTGAGAGGACCAT
C
ACTGTGAAGGGCGCCATTGAGAACTGTTGCAGGGCCGAGCAGGAGATCATGAAGAAAGTTCGAGAGGCT
TAC
GAGAACGACGTGGCCGCCATGAGCTTGCAGTCCCACCTCATCCCTGGGCTTAACCTGGCTGCTGTAG
GT
CTCTTCCCAGCTTCATCCAGCGCTGTCCCTCCTCCTCCCAGCAGTGTCACCGGGGCTGCTCCCTATAG
C
TCCTTCATGCAGGCTCCGGAGCAGGAGATGGTACAAGTGTTCATCCCCGCCCAGGCTGTGGGCGCCATC
ATT
GGCAAGAAGGGCCAGCACATCAAACAACTCTCCCGCTTCGCCAGCGCCTCCATCAAGATTGCACCAC
CA
GAAACACCTGACTCCAAAGTTCGAATGGTCGTCATCACTGGACCCCCAGAGGCTCAGTTCAAGGCCCA
G
GGAAGAATCTATGGCAAACTAAAAGAAGAGAATTTCTTTGGTCCCAAGGAGGAAGTAAAGCTAGAGACC
CAC
ATACGGGTTCCGGCTTCAGCAGCCGGCCGTGTCATCGGCAAAGGCGGCAAAACGGTGAATGAGCTGC
AG
AACTTGACCGCAGCTGAGGTGGTAGTGCCAAGAGACCAGACCCCGGATGAGAACGACCAAGTCATTGT
T
AAGATCATCGGACATTTCTATGCCAGCCAGATGGCTCAGCGGAAGATCCGAGACATCCTGGCTCAAGTT
AAG
CAACAGCACCAGAAGGGACAGAGCAACCTGGCCCAGGCTCGGAGGAAGTGA


Translation (577 aa):
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEI
E
HSVPKKQ
RSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLN
G
HQLENHALKVSYIPDEQITQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAI
I
GKEGATIRNITKQTQS
KIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLK
I
LAHNNFVGRLIGKEGRNLKKVEQDTETKITIS
SLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREA
Y
ENDVAAMS
LQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
I
GKKGQHIKQLSRFASASIK
IAPPETPDSKVRMVVITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLET
H
IRVPASAAGRVIGKGGKT
VNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQV
K
QQHQKGQSNLAQARRK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser