NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25980.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25980.1 Public Mus musculus 12 Kcnh5 16 104 75 CCDS HistoryNCBI Gene:238271Re-query CCDS DB by CCDS ID:25980.1Re-query CCDS DB by GeneID:238271See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25980.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042299 ENSMUSP00000046864 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042299Link to Ensembl Protein Viewer:ENSMUSP00000046864Re-query CCDS DB by Nucleotide ID:ENSMUST00000042299Re-query CCDS DB by Protein ID:ENSMUSP00000046864
Original member Current member NCBI NM_172805.3 NP_766393.2 Accepted alive Link to Nucleotide Sequence:NM_172805.3Link to Protein Sequence:NP_766393.2Re-query CCDS DB by Nucleotide ID:NM_172805Re-query CCDS DB by Protein ID:NP_766393Link to BLink:NP_766393.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766393.2 988 Q920E3 988 100% 0 0

Chromosomal Locations for CCDS 25980.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 74897507 74898454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 74965125 74965321 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 74976471 74976723 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75007600 75007799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75087405 75087831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75114191 75114583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75119921 75120036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75130898 75131026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75137644 75137750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75154158 75154281 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 75176456 75176528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2967 nt):
ATGCCGGGGGGCAAGAGAGGGCTGGTGGCTCCGCAGAACACATTTTTGGAGAACATCGTCAGGCGCTCCA
GT
GAATCAAGTTTCTTACTGGGAAATGCCCAAATTGTGGACTGGCCTGTAGTTTATAGTAATGACGGTTT
T
TGTAAACTCTCTGGATATCATCGAGCTGACGTCATGCAGAAAAGCAGCACCTGCAGTTTTATGTATGGA
GAA
CTGACCGACAAGAAGACCATTGAGAAAGTCAGGCAGACTTTTGACAACTACGAGTCAAACTGTTTTG
AA
GTTCTTCTGTACAAAAAAAACCGTACCCCTGTTTGGTTTTACATGCAAATCGCACCAATAAGAAATGA
A
CACGAGAAGGTGGTCTTGTTCCTGTGTACATTCAAGGACATTACACTGTTCAAACAGCCTATAGAGGAT
GAC
TCAACGAAAGGTTGGACGAAGTTTGCCCGATTGACACGGGCTTTGACAAATAGCCGAAGTGTTTTAC
AG
CAGCTTACACCAATGAATAAAACAGAGACAGTCCACAAGCATTCAAGACTAGCTGAAGTGCTTCAGCT
G
GGATCAGACATCCTTCCTCAGTACAAACAAGAAGCGCCAAAGACGCCACCACATATCATCTTACACTAT
TGT
GCTTTTAAAACTACTTGGGATTGGGTGATTTTAATTCTTACCTTCTACACCGCCATCATGGTTCCTT
AC
AATGTTTCTTTCAAAACAAAGCAGAACAATATCGCCTGGCTGGTGCTGGACAGTGTGGTGGACGTGAT
T
TTTCTGGTGGACATTGTTTTAAATTTTCACACGACTTTTGTGGGGCCGGGTGGAGAGGTCATTTCTGAC
CCG
AAGCTTATAAGGATGAACTATCTGAAAACTTGGTTTGTGATTGATCTGCTGTCTTGTTTACCTTATG
AC
ATCATCAATGCCTTTGAAAATGTGGATGAGGGAATCAGCAGTCTCTTCAGCTCTTTAAAGGTGGTGCG
C
CTTTTACGCCTGGGCCGTGTTGCTAGGAAACTGGACCATTACCTGGAATATGGAGCAGCGGTCCTTGTG
CTC
CTGGTATGTGTGTTTGGACTGGTGGCTCACTGGCTGGCTTGCATCTGGTACAGCATTGGAGACTATG
AG
GTCATTGATGAAGTCACCAACACCATTCAAATAGACAGCTGGCTCTACCAGTTGGCCTTGAGCATTGG
G
ACCCCATATCGCTACAATACGAGTGCAGGGATCTGGGAAGGAGGACCCAGCAAGGACTCCCTGTATGTG
TCC
TCCCTCTACTTCACCATGACGAGCCTTACAACCATAGGATTTGGAAACATAGCTCCGACCACAGACG
TG
GAGAAGATGTTCTCAGTGGCCATGATGATGGTCGGCTCTCTTCTTTATGCAACTATTTTTGGAAATGT
T
ACCACAATTTTCCAGCAAATGTATGCCAACACCAACCGTTACCATGAGATGCTGAATAATGTTCGAGAT
TTC
CTGAAATTATATCAGGTCCCAAAAGGCCTTAGTGAACGAGTGATGGATTATATTGTCTCAACATGGT
CA
ATGTCAAAAGGCATCGACACAGAGAAGGTCCTCTCCATCTGTCCCAAGGACATGAGAGCTGACATCTG
T
GTTCATCTGAACCGGAAGGTTTTTAATGAACATCCTGCATTCCGATTGGCCAGCGATGGATGTCTGCGT
GCC
TTGGCAGTGGAGTTCCAAACCATTCACTGTGCTCCTGGGGACCTGATTTACCATGCTGGAGAGAGTG
TG
GATGCCCTCTGCTTTGTGGTGTCCGGGTCCTTGGAAGTTATCCAGGATGAGGAGGTGGTGGCCATTTT
A
GGGAAAGGTGACGTGTTTGGAGACATCTTCTGGAAGGAAACCACCCTTGCTCATGCGTGTGCCAATGTC
CGG
GCCCTGACTTACTGTGATCTGCACATCATCAAGCGAGAAGCCTTGCTCAAGGTCCTTGACTTCTATA
CA
GCATTTGCAAACTCATTTTCCAGGAACCTCACTCTCACTTGCAATCTAAGGAAGCGGATCATCTTCCG
T
AAAATTAGTGATGTGAAGAAGGAGGAGGAGGAGCGGCTGCGGCAGAAGAATGAGGTGACTCTGAGCATC
CCC
GTGGACCACCCAGTGAGGAAGCTCTTCCAGAAGTTCAAACAGCAGAAAGAACTGAGGATCCAGGGCT
CT
GCACAGAGTGATCCTGAGAGGAGCCAGCTTCAGGTAGAGAGCCGCCCTTTGCAGAACGGAGCCTCCAT
C
ACAGGTACCAGTGTGGTCACCGTATCACAGATTACCCCCATCCAGACGTCTCTGGCGTATGTGAAAACC
AGC
GAGTCTCTTAAGCAGAACAACCGCGATGCCATGGAACTGAAGCCCAATGGTGGCGCTGAACCCAAAT
GT
CTCAAGGTCAACAGCCCCATCAGGATGAAAAACGGAAATGGGAAGGGGTGGCTGAGACTCAAGAACAA
C
ATGGGGGCTCAGGAGGAGAAAAAGGAAGACTGGAATAATGTCACCAAAGCCGAGTCGATGGGGCTCTTG
TCG
GAGGACCCCAAGGGCAGTGACTCAGAGAACAGTGTGACCAAGAACCCCTTAAGGAAAACGGATTCTT
GT
GACAGTGGGATTACAAAAAGTGACCTTCGTTTGGATAAAGCCGGTGAGGCCCGAAGTCCTCTAGAACA
C
AGCCCCAGCCAGGCTGATGTCAAGCATTCTTTCTACCCCATCCCCGAGCAGGCCTTACAAACCACACTG
CAG
GAAGTCAAACATGAACTCAAGGAGGATATCCAGCTGCTAAGCTGCAGAATGACTGCCCTGGAAAAGC
AG
GTGGCAGAGATTTTAAAACTACTCTCAGAGAAAAGCGTACCCCAGACATCTTCTCCAAAACCCCAAAT
T
CCACTCCAAGTACCTCCCCAAATACCATGTCAGGATATTTTTAGTGTCTCAAGGCCTGAGTCACCCGAA
TCT
GACAAAGACGAAATCAACTTTTAA


Translation (988 aa):
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYG
E
LTDKKTIEKVRQTFDNYESNCFEVLLYKKN
RTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED
D
STK
GWTKFARLTRALTNSRSVLQQLTPMNKTETVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHY
C
AFKTTWDWVILILTFYTAIMVPYNVSFKTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISD
P
KLIRMNYLKTWFVIDLLSCLPYDIINAFENVDE
GISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLV
L
LVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
S
SLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG
SLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRD
F
LKLYQVPKGLSERVMDYIVSTWSMSKGIDTEK
VLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLR
A
LAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAIL
GKGDVFGDIFWKETTLAHACANV
R
ALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKR
IIFRKISDVKKEEEERLRQKNEVTLSI
P
VDHPVRKLFQKFKQQKELRIQGSAQSDPERSQLQVESRPLQNGASITGTSVVTVSQITPIQTSLAYVKT
S
ESLKQNNRDAMELKPNGGAEPKCLKVNSPIRMKNGNGKGWLRLKNNMGAQEEKKEDWNNVTKAESMGLL
S
EDPKGSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPSQADVKHSFYPIPEQALQTTL
Q
EVKHELKEDIQLLSCRMTALEKQVAEILKLLSEKSVPQTSSPKPQIPLQVPPQIPCQDIFSVSRPESPE
S
DKDEINF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser