NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27559.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27559.1 Public Mus musculus 15 Fam83h 16 104 75 CCDS HistoryNCBI Gene:105732Re-query CCDS DB by CCDS ID:27559.1Re-query CCDS DB by GeneID:105732See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27559.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060807 ENSMUSP00000059839 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060807Link to Ensembl Protein Viewer:ENSMUSP00000059839Re-query CCDS DB by Nucleotide ID:ENSMUST00000060807Re-query CCDS DB by Protein ID:ENSMUSP00000059839
Original member Current member EBI,WTSI ENSMUST00000170153 ENSMUSP00000126453 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170153Link to Ensembl Protein Viewer:ENSMUSP00000126453Re-query CCDS DB by Nucleotide ID:ENSMUST00000170153Re-query CCDS DB by Protein ID:ENSMUSP00000126453
Original member Current member NCBI NM_001168253.1 NP_001161725.1 Accepted alive Link to Nucleotide Sequence:NM_001168253.1Link to Protein Sequence:NP_001161725.1Re-query CCDS DB by Nucleotide ID:NM_001168253Re-query CCDS DB by Protein ID:NP_001161725Link to BLink:NP_001161725.1
Original member Current member NCBI NM_134087.2 NP_598848.2 Accepted alive Link to Nucleotide Sequence:NM_134087.2Link to Protein Sequence:NP_598848.2Re-query CCDS DB by Nucleotide ID:NM_134087Re-query CCDS DB by Protein ID:NP_598848Link to BLink:NP_598848.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161725.1 1209 Q148V8 1209 100% 0 0
NP_598848.2 1209 Q148V8 1209 100% 0 0

Chromosomal Locations for CCDS 27559.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 76001857 76004749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76004941 76005065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76005135 76005299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76006101 76006547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3630 nt):
ATGGCCCGTCGCTCCCAGAGCAGCTCGCAGGGGGACAACCCACTGGCACCTGGGTACCTGCCACCTCACT
AC
AAAGAATATTACCGCCTAGCGGTGGATGCATTGACTGAGGGTGGGCCAGAAGCCTACAACCGCTTCTT
G
GCATCTGAGGGGGCACCTGACTTCCTGTGCCCTGAGGAACTGGAACACGTGAGCCGCCACCTGCAGCCC
CCA
CAGTATGTGGCCCGGGAACCCCCTGAAGGCACCCCATCTGATGTGGACATGGACGGGTCCTCAGGCA
CC
TACTGGCCAGTGAACTCAGACCAGGCTGTGCCTGAGCTGGACCTGGGCTGGCCCCTCACATTTGGCTT
C
CAAGGCACAGAGGTCACCACACTGGTACAGCCGCCGCCACCTGACAGCCCCAGCATCAAAGATGAAGCT
CGG
AGGATGATCCGCTCTGCCCAGCAGGTGGTAGCTGTGGTGATGGACATGTTTACCGACGTGGATCTGC
TC
AGTGAGGTGCTAGAGGCCGCTGCAAGGCGAGTCCCGGTCTACATTCTGCTGGATGAAATGAACGCCCA
G
CACTTCCTAGACATGGCCGACAAGTGTCGCGTCAACCTGCATCATGTGGACTTCCTGCGTGTGCGCACA
GTG
GCAGGTCCTACTTACTACTGCCGCACTGGGAAGTCTTTCAAGGGCCATCTAAAGGAGAAGTTCTTGC
TT
GTGGACTGTGCCGTAGTGATGAGCGGCAGTTATAGCTTCATGTGGTCCTTCGAGAAAATCCACCGCAG
C
CTGGCTCATGTGTTCCAGGGAGAGTTGGTCTCCAGCTTCGACGAAGAGTTCCGCATCCTCTTCGCACAG
TCG
GAGCCACTGGTGCCCTCAGCCGGGGCGCTAGCCCGCATGGATGCCTATGCGCTAGCTCCATACTCTG
GG
GCTGGGCCCCTGGTGGGCGTCCCCGGGGTTGGAGCACCAACACCTTTTTCTTTCCCTAAACGGGCGCA
C
CTCCTATTCCCACCGCCCAGGGAAGAAGGCCTGGGCTTCCCCTCTTTCCTAGACCCTGACCGCCACTTC
CTG
TCGGCTTTCCGCCGAGAGGAGCTGCAGAGAATGCCTGGGGGTGCTTTGGAGCCTCACACAGGGCTCC
GG
CCACTGGCGCGCCCAACTGAGGCTGGGCCGTTCGGAGAGCTCGCGGGCCCCCGGGGCTTCTTCCAGTC
A
AGGCACCTGGAAATGGATGCCTTCAAGCGGCATAGCTACGCAACACCCGATGGAGCTGGAGCAGTGGAG
AAC
TTTGCAGCGGCACGGCAGGTGTCACGACAAACATTCCTCAGTCACGGTGATGACTTCCGTTTCCAGA
CC
AGCCACTTCCAACGGGACCAGCTCTATCAGCAGCATTACCAGTGGGACCCACAGTTTGCTCCTGCGCG
C
CCACAGGGCCTCTTCGAGAAGCTTCGTGCAGGCCGACCTGGCTTTGCGGACCCTGATGACTTTGCCTTA
GGT
GCTGGTCACCGCTTCCCAGAACTCGGTGCTGATGTGCACCAACGGCTGGAATACGTGCCATCCAGCG
CA
TCTCGGGAGGTACGCCACGGCTCGGATCCGGCCTTTGGACCCAGCCCCCGTGGTCTAGAGCCCAGTGG
A
GCCTCGCGTCCCAATCTGGGCCAGCGTTTTCCATGCCAAGCAACCTTGAGACAAGGCCTGGACACCGCT
TCG
GAGGCAGAACCTGAGCGCAGGGGCGGACCCGAGGGCCGGGCCGGGCTGCGTCACTGGCGCCTTGCCT
CC
TACCTGAGCGGCTGCCACGGTGACGGTGGGGAGGAGGGTCTACCAATGGAGGCTGAGGCTTGTGAAGA
C
GAGGTGCTGGCTCCCGGAGGCCGGGACCTGCTCCCCTCCGCCTTCCGCACTCCTGCAGCCTTCCCAGCT
AAG
GGACCAAAGCCGGGCTCAGGAAGCGGTGGTGGTGACAGCTCCGAGCGAGAGGGCCCAGAAGAGACAA
GC
CTGGCTAAGCAGGACTCCTTCCGCTCTCGCTTGAACCCGCTCATCCAGCGCAGCTCCAGGTTGCGCTC
A
TCACTCATCTTTGCGTCCCAGGCTGAGGGTGCTGTTGGGACCGCAGCAGCCACCACTGAAAAAGTACAG
CTG
ATGCACAAAGAACAAACAGTCAGTGAAACTCTGGGTCCCAGCGGAGAGGCTGTTCGTTCCAGCGCCT
CG
GCCAAAGTGGCGGAGCTCCTGGAGAAATACAAGGGCCCTGCCCGGGACCCTGGCGGTGCAGGAGGTGC
C
GTCACTTCCTCCAGCCACAGCAAGGCTGTAGTGTCCCAGGCCTGGCGGGAGGAGGTGGTAGCACCAGGA
GGA
GCGGGAACTGAACGCCGCAGCCTTGAGAGTTGCTTGCTTGACCTGCGCGATTCCTTTGCCCAGCAGT
TG
CACCAGGAGGCAGAGCGACACCCAGGAGCCGCTTCGCTCACTGCTGCGCAACTGCTCGACACCCTGGG
C
GGCACTGACCGCCTGCCATCACGCTTCCTCTCCGCCCAGGGCCGCTCCTTGTCTCCACAAGGTCGAGAT
AGC
CCTCCGCCAGAAGGGCTTGGGACACACCAGCTGCCTTATTCTGAGCCAAAGGGAAACCCCACCCCAG
CT
TACCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTACCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTA
C
CCTGAGCGCAAGGGGAGCCCTACCCCAGCTTACCCTGAGCGCAAGGGGAGTCCTACCCAAGCCTACCCT
GAG
CGCAAGGGGAGCCCCACGTCTGGATTTCCCAATCGGAGGGGCAGCCCAACCACAGGATTGATGGAGC
AG
AAGGGAAGTCCCACTTCAACCTACCCAGACCGCAGGGGCAGTCCGGTGCCCCCAGTGCCTGAGCGCAG
G
GGTAGTCCAGTACCCCCTGTGCCCGAGCGCAGAGGCAGTCTCACTTTCGCTGGGGAGTCTTCGAAGACT
GGG
CCTACAGAGGAGGTGTCTAGTGGCCCCATGGAAGTCCTGCGAAAGGGTTCTCTCCGCCTCAGGCAGC
TG
CTGAGCCCCAAGAATGAGAGGCGTGGGGAGGATGAGGGCAGCTTCCCAACTCCGCAGGAAAATGGGCA
G
CCCGAGAGCCCCCGGCGGCCCTCGCTGAGTCGGGGTGACAGCACAGAGGCTGCTGCAGAGGAGAGAGGC
TCG
AGGGTCCGCCTAGCTTCAGCTACAGCCAATGCTCTGTACAGCAGCAATCTGCGAGATGACACTAAGG
CC
ATTCTGGAGCAAATTAGTGCCCACGGCCAGAAGCACCGCGGGGTCCCTGCTCCAGGTCCAGCCCACAG
C
AGTCCTGACGTAGGTCGTCCAACAACTGCAGGAGACTTGGCCCCAGACATGTCCGACAAGGACAAATGT
TCA
GCTATCTTCCGCTCAGACAGCCTAGGGACACAAGGCCGGCTCAGCCGCACCCTGCCTGGCAGTGCAG
AG
GAGCGAGACCGGCTCCTTCGCCGCATGGAGAGCATGCGCAAAGAGAAGCGTGTCTACAGTCGCTTCGA
A
GTCTTCTGCAAAAAGGACGAAGCTGGCAGTAGTGGGGCAGGAGACAACTTGGCAGATGAGGACACCAGG
GAC
AGTAAAATGGGCAAATTTGTCCCCAAGATCCTGGGCACATTCAAAAGCAAAAAATGA


Translation (1209 aa):
MARRSQSSSQGDNPLAPGYLPPHYKEYYRLAVDALTEGGPEAYNRFLASEGAPDFLCPEELEHVSRHLQP
P
QYVAREPPEGTPSDVDMDGSSGTYWPVNSDQAVPELDLGWPLTFGFQGTEVTTLVQPPPPDSPSIKDEA
R
RMIRSAQQ
VVAVVMDMFTDVDLLSEVLEAAARRVPVYILLDEMNAQHFLDMADKCRVNLHHVDFLRVRT
V
AGPTYYCRTGKSFKGHLKEKFLLVDCAVVMSGSY
SFMWSFEKIHRSLAHVFQGELVSSFDEEFRILFAQ
S
EPLVPSAGALARMDAYALAPYSGAGPLVGVPGVGAPTPFSFPKRAHLLFPPPREEGLGFPSFLDPDRHF
L
SAFRREELQRMPGGALEPHTGLRPLARPTEAGPFGELAGPRGFFQSRHLEMDAFKRHSYATPDGAGAVE
N
FAAARQVSRQTFLSHGDDFRFQTSHFQRDQLYQQHYQWDPQFAPARPQGLFEKLRAGRPGFADPDDFAL
G
AGHRFPELGADVHQRLEYVPSSASREVRHGSDPAFGPSPRGLEPSGASRPNLGQRFPCQATLRQGLDTA
S
EAEPERRGGPEGRAGLRHWRLASYLSGCHGDGGEEGLPMEAEACEDEVLAPGGRDLLPSAFRTPAAFPA
K
GPKPGSGSGGGDSSEREGPEETSLAKQDSFRSRLNPLIQRSSRLRSSLIFASQAEGAVGTAAATTEKVQ
L
MHKEQTVSETLGPSGEAVRSSASAKVAELLEKYKGPARDPGGAGGAVTSSSHSKAVVSQAWREEVVAPG
G
AGTERRSLESCLLDLRDSFAQQLHQEAERHPGAASLTAAQLLDTLGGTDRLPSRFLSAQGRSLSPQGRD
S
PPPEGLGTHQLPYSEPKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTQAYP
E
RKGSPTSGFPNRRGSPTTGLMEQKGSPTSTYPDRRGSPVPPVPERRGSPVPPVPERRGSLTFAGESSKT
G
PTEEVSSGPMEVLRKGSLRLRQLLSPKNERRGEDEGSFPTPQENGQPESPRRPSLSRGDSTEAAAEERG
S
RVRLASATANALYSSNLRDDTKAILEQISAHGQKHRGVPAPGPAHSSPDVGRPTTAGDLAPDMSDKDKC
S
AIFRSDSLGTQGRLSRTLPGSAEERDRLLRRMESMRKEKRVYSRFEVFCKKDEAGSSGAGDNLADEDTR
D
SKMGKFVPKILGTFKSKK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser