NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37203.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37203.1 Public Mus musculus 15 Faim2 16 104 75 CCDS HistoryNCBI Gene:72393Re-query CCDS DB by CCDS ID:37203.1Re-query CCDS DB by GeneID:72393See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37203.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023750 ENSMUSP00000023750 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023750Link to Ensembl Protein Viewer:ENSMUSP00000023750Re-query CCDS DB by Nucleotide ID:ENSMUST00000023750Re-query CCDS DB by Protein ID:ENSMUSP00000023750
Original member Current member NCBI NM_028224.4 NP_082500.2 Accepted alive Link to Nucleotide Sequence:NM_028224.4Link to Protein Sequence:NP_082500.2Re-query CCDS DB by Nucleotide ID:NM_028224Re-query CCDS DB by Protein ID:NP_082500Link to BLink:NP_082500.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082500.2 317 Q8K097-1 317 100% 0 0

Chromosomal Locations for CCDS 37203.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 99500148 99500297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99510582 99510635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99512496 99512591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99512781 99512868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99513349 99513386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99513917 99513956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99514400 99514450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99520302 99520355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99520709 99520773 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99521169 99521272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99524701 99524899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99527580 99527594 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGACCCAGGGAAAGCTCTCTGTGGCTAACAAGGCCCCCGGGACTGAGGGGCAGCAGCACCAGGCAAATG
GA
GAGAAGAAGGATGCTCCGGCAGTGCCCTCGGCGCCACCCTCCTATGAGGAGGCCACCTCTGGAGAGGG
G
CTGAAGGCAGGGACCTTCCCCCAGGGCCCAACAGCTGTGCCACTCCATCCAAGCTGGGCCTACGTGGAC
CCC
AGCGGCAGCTCCGGCTATGAAGGTGGTTTCCCCGCAGGACATCACGAGCATTTCACCACCTTCAGCT
GG
GATGACCAGAAAGTTCGTCGGCTCTTCATCAGAAAGGTCTATACCATCCTATTGGTCCAGCTGCTGGT
G
ACCTTGGCTGTGGTGGCTCTCTTTACCTTCTGTGATGTCGTTAAGGACTATGTCCAGGCTAACCCCGGC
TGG
TACTGGGCGTCCTATGCCGTGTTCTTTGCAACTTACCTGACTCTGGCTTGCTGTTCTGGACCCAGGA
GA
CATTTCCCTTGGAACCTGATTCTGCTGACCATCTTTACCCTGTCCATGGCCTACCTCACTGGGATGCT
G
TCCAGTTACTACAACACCACATCTGTGCTGCTGTGCCTGGTCATCACGGCTCTCGTCTGCCTCTCGGTC
ACC
ATCTTCAGTTTCCAGACCAAGTTTGACTTCACCTCCTGTCAGGGTGTGCTGTTTGTGCTGCTCATGA
CC
CTCTTCTTCAGTGGACTCCTCCTCGCTGTCCTCCTGCCCTTCCAATACGTCCCCTGGCTCCACGCGGT
C
TATGCTGTACTGGGAGCGGGTGTGTTCACGTTGTTCCTGGCCTTTGATACCCAGTTGCTGATGGGTAAC
CGT
CGACACTCGCTGAGCCCCGAGGAGTATATTTTTGGAGCCCTCAACATCTACTTAGACATTATCTATA
TC
TTCACCTTCTTCCTGCAGCTTTTTGGCACCAACCGGGAATGA


Translation (317 aa):
MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAVPLHPSWAYVD
P
SGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPG
W
YWAS
YAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSV
T
IFSFQTK
FDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGN
R
RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser