NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16060.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16060.1 Public Mus musculus 2 Itgb6 16 104 75 CCDS HistoryNCBI Gene:16420Re-query CCDS DB by CCDS ID:16060.1Re-query CCDS DB by GeneID:16420See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16060.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028348 ENSMUSP00000028348 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028348Link to Ensembl Protein Viewer:ENSMUSP00000028348Re-query CCDS DB by Nucleotide ID:ENSMUST00000028348Re-query CCDS DB by Protein ID:ENSMUSP00000028348
Original member Current member EBI,WTSI ENSMUST00000059888 ENSMUSP00000054944 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059888Link to Ensembl Protein Viewer:ENSMUSP00000054944Re-query CCDS DB by Nucleotide ID:ENSMUST00000059888Re-query CCDS DB by Protein ID:ENSMUSP00000054944
Original member Current member EBI,WTSI OTTMUST00000030629 OTTMUSP00000013748 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030629Link to Vega Protein Viewer:OTTMUSP00000013748Re-query CCDS DB by Nucleotide ID:OTTMUST00000030629Re-query CCDS DB by Protein ID:OTTMUSP00000013748
Original member Current member EBI,WTSI OTTMUST00000030865 OTTMUSP00000013830 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030865Link to Vega Protein Viewer:OTTMUSP00000013830Re-query CCDS DB by Nucleotide ID:OTTMUST00000030865Re-query CCDS DB by Protein ID:OTTMUSP00000013830
Original member Current member NCBI NM_001159564.1 NP_001153036.1 Accepted alive Link to Nucleotide Sequence:NM_001159564.1Link to Protein Sequence:NP_001153036.1Re-query CCDS DB by Nucleotide ID:NM_001159564Re-query CCDS DB by Protein ID:NP_001153036Link to BLink:NP_001153036.1
Original member Current member NCBI NM_021359.3 NP_067334.1 Accepted alive Link to Nucleotide Sequence:NM_021359.3Link to Protein Sequence:NP_067334.1Re-query CCDS DB by Nucleotide ID:NM_021359Re-query CCDS DB by Protein ID:NP_067334Link to BLink:NP_067334.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153036.1 787 Q9Z0T9 787 100% 0 0
NP_067334.1 787 Q9Z0T9 787 100% 0 0

Chromosomal Locations for CCDS 16060.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 60600485 60600583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60605140 60605306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60611367 60611486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60616645 60616739 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60620211 60620433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60627748 60628165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60628335 60628469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60634580 60634669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60649974 60650069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60653142 60653303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60654639 60654804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60668288 60668534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60669102 60669306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60672632 60672711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60673402 60673462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2364 nt):
ATGGGGATTGAGCTGGTCTGCCTGTTTCTGCTACTTCTAGGAAGGAATGATCACGTCCAAGGTGGCTGTG
CC
TGGGGTGGTGCAGAAAGCTGCTCAGACTGCCTGCTCACAGGACCCCACTGCGCCTGGTGCTCCCAGGA
G
AATTTCACCCACCTGTCTGGAGCTGGCGAGAGGTGCGACACCCCAGCGAATCTTTTAGCCAAAGGATGT
CAA
CTACCCTTCATTGAAAACCCTGTCTCCCGCATAGAAGTCCTTCAAAATAAGCCTCTCAGCGTGGGCC
GA
CAGAAGAACAGTTCTGACATTGTTCAGATTGCTCCTCAAAGCTTGGTTCTTAAATTGAGACCAGGGCG
T
GAGCAGACTCTGCAAGTGCAGGTCCGCCAAACTGAAGATTACCCAGTAGATCTGTATTACCTCATGGAC
CTC
TCCGCCTCTATGGATGACGACCTCAACACCATCAAAGAGCTTGGCTCCCGGCTGGCCAAAGAGATGT
CC
AAACTAACCAGCAACTTTAGACTGGGCTTTGGCTCTTTTGTGGAAAAGCCCGTTTCTCCTTTTATGAA
A
ACAACCCCAGAGGAAATCACCAACCCTTGCAGTAGTATCCCCTATTTCTGCTTACCTACATTTGGATTC
AAG
CACATTTTGCCATTAACTGATGATGCCGAGAGATTCAATGAAATTGTGAGGAAACAGAAGATTTCTG
CT
AATATTGACACACCTGAAGGTGGATTTGATGCAATCATGCAGGCTGCTGTGTGTAAGGAAAAGATTGG
C
TGGCGCAATGACTCGCTCCACCTCCTGGTTTTTGTGAGTGATGCCGATTCTCATTTTGGAATGGACAGC
AAG
CTGGCAGGCATTGTCATTCCCAATGATGGACTCTGTCACTTGGACCACAGGAATGAATATTCCATGT
CA
ACTGTCTTGGAATATCCAACTATCGGCCAACTCATTGATAAACTGGTACAAAACAACGTGCTACTGAT
C
TTTGCAGTCACCCAAGAACAAGTCCATCTGTATGAGAACTATGCAAAACTCATTCCTGGAGCAACCGTG
GGA
CTGCTTCAGAAGGATTCTGGGAACATCCTTCAGCTGATCATCTCCGCTTATGAAGAACTGCGGTCTG
AG
GTGGAACTGGAAGTGTTAGGGGACACAGAAGGACTCAACCTGTCTTTCACAGCTCTCTGTAACAATGG
T
GTCCTCTTCCCACACCAAAAGAAATGCTCCCACATGAAAGTTGGAGACACAGCATCCTTCAATGTGACT
GTG
AGCGTATCCAACTGTGAGAAAAGAAGCAGGAACCTCATCATAAAGCCAGTGGGGCTGGGGGACACCC
TA
GAAATACTCGTCAGTGCAGAATGTGACTGCGACTGCCAGAGAGAAATAGAAACTAACAGCTCTAAGTG
T
CACAATGGGAATGGCTCCTTCCAGTGTGGGGTGTGTACCTGCAACCCCGGCCACATGGGTCCTCACTGC
GAG
TGTGGTGAGGATATGGTGAGCACGGATTCCTGCAAGGAGTCCCCGGGTCACCCTTCATGCAGTGGAA
GG
GGTGACTGCTATTGTGGGCAGTGCATCTGCCACTTATCGCCGTACGGAAGCATCTACGGACCTTACTG
C
CAGTGTGACAACTTCTCCTGTCTGAGACACAAAGGCCTTCTCTGTGGAGATAACGGTGACTGTGACTGT
GGC
GAGTGTGTGTGCCGGGATGGCTGGACAGGTGAATACTGTAACTGTACAACCAACAGGGACTCGTGTA
CA
TCTGAGGATGGAGTGCTGTGCAGTGGACGTGGGGACTGTGTCTGTGGCAAGTGTGTCTGCAGAAACCC
T
GGAGCCTCAGGACCCACCTGTGAACGCTGTCCTACCTGTGGCGACCCCTGTAACTCTAAACGGAGTTGC
ATC
GAGTGCTACCTGTCTGCAGATGGCCAGGCCCAAGAAGAGTGTGCTGACAAGTGTAAAGCCATTGGTG
CC
ACCATCAGTGAGGAAGATTTTTCAAAGGATACTTCTGTCTCCTGCTCTCTACAAGGAGAAAATGAATG
C
CTTATTACATTCCTAATAACTACGGATAATGAAGGGAAAACCATCATTCACAACATCAATGAAAAAGAC
TGC
CCCAAACCTCCAAACATTCCCATGATCATGTTGGGGGTGTCACTGGCGATCCTGCTCATCGGAGTTG
TG
CTACTGTGCATTTGGAAGCTGCTGGTATCATTTCATGACCGGAAGGAAGTTGCTAAATTTGAAGCAGA
A
CGCTCTAAGGCCAAGTGGCAAACGGGAACCAATCCTCTGTACCGAGGTTCCACCAGCACTTTTAAGAAC
GTG
ACCTACAAGCACAGGGAGAAGCACAAAGCAGGCCTTTCCTCAGATGGGTAG


Translation (787 aa):
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCDTPANLLAKGC
Q
LPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRP
GREQTLQVQVRQTEDYPVDLYYLMD
L
SASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEITNPC
SSIPYFCLPTFGF
K
HILPLTDDAERFNEIVRKQKISANIDTPEGGFDAIMQAAVCK
EKIGWRNDSLHLLVFVSDADSHFGMDS
K
LAGIVIPNDGLCHLDHRNEYSMSTVL
EYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV
G
LLQKDSGNILQLIISAYE
ELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
V
SVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCTCNPGHMGPHC
E
CGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCDNFSCLRHKGLLCG
DNGDCDC
G
ECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCGKCVCRNPGASGPTCERCPTCGDPCNSK
RSC
I
ECYLSADGQAQEECADKCKAIGATISEE
DFSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKD
C
PKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQT
GTNPLYRGSTSTFKN
V
TYKHREKHKAGLSSDG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser