NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25315.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25315.1 Public Mus musculus 11 Tbx21 16 104 75 CCDS HistoryNCBI Gene:57765Re-query CCDS DB by CCDS ID:25315.1Re-query CCDS DB by GeneID:57765See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25315.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000001484 ENSMUSP00000001484 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001484Link to Ensembl Protein Viewer:ENSMUSP00000001484Re-query CCDS DB by Nucleotide ID:ENSMUST00000001484Re-query CCDS DB by Protein ID:ENSMUSP00000001484
Original member Current member EBI,WTSI OTTMUST00000004472 OTTMUSP00000002150 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000004472Link to Vega Protein Viewer:OTTMUSP00000002150Re-query CCDS DB by Nucleotide ID:OTTMUST00000004472Re-query CCDS DB by Protein ID:OTTMUSP00000002150
Original member Current member NCBI NM_019507.2 NP_062380.2 Accepted alive Link to Nucleotide Sequence:NM_019507.2Link to Protein Sequence:NP_062380.2Re-query CCDS DB by Nucleotide ID:NM_019507Re-query CCDS DB by Protein ID:NP_062380Link to BLink:NP_062380.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062380.2 530 Q9JKD8 530 100% 0 0

Chromosomal Locations for CCDS 25315.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 97098772 97099378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97099770 97099831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97099927 97100085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97101479 97101600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97101944 97102098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97114650 97115137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1593 nt):
ATGGGCATCGTGGAGCCGGGCTGCGGAGACATGCTGACCGGCACCGAGCCGATGCCGAGTGACGAGGGCC
GG
GGGCCCGGAGCGGACCAACAGCATCGTTTCTTCTATCCCGAGCCGGGCGCACAGGACCCGACCGATCG
C
CGCGCAGGTAGCAGCCTGGGGACGCCCTACTCTGGGGGCGCCCTGGTGCCTGCCGCGCCGGGTCGCTTC
CTT
GGATCCTTCGCCTACCCGCCCCGGGCTCAGGTGGCTGGCTTTCCCGGGCCTGGCGAGTTCTTCCCGC
CG
CCCGCGGGTGCGGAGGGCTACCCGCCCGTGGATGGCTACCCTGCCCCTGACCCGCGCGCGGGGCTCTA
C
CCAGGGCCGCGCGAGGACTACGCATTGCCCGCGGGGTTGGAGGTGTCTGGGAAGCTGAGAGTCGCGCTC
AGC
AACCACCTGTTGTGGTCCAAGTTCAACCAGCACCAGACAGAGATGATCATCACTAAGCAAGGACGGC
GA
ATGTTCCCATTCCTGTCCTTCACCGTGGCCGGGCTGGAGCCCACAAGCCATTACAGGATGTTTGTGGA
T
GTGGTCTTGGTGGACCAGCACCACTGGCGGTACCAGAGCGGCAAGTGGGTGCAGTGTGGAAAGGCAGAA
GGC
AGCATGCCAGGGAACCGCTTATATGTCCACCCAGACTCCCCCAACACCGGAGCCCACTGGATGCGCC
AG
GAAGTTTCATTTGGGAAGCTAAAGCTCACCAACAACAAGGGGGCTTCCAACAATGTGACCCAGATGAT
C
GTCCTGCAGTCTCTCCACAAGTACCAGCCCCGGCTGCACATCGTGGAGGTGAATGATGGAGAGCCAGAG
GCT
GCCTGCAGTGCTTCTAACACACACGTCTTTACTTTCCAAGAGACCCAGTTCATTGCAGTGACTGCCT
AC
CAGAACGCAGAGATCACTCAGCTGAAAATCGACAACAACCCCTTTGCCAAAGGATTCCGGGAGAACTT
T
GAGTCCATGTACGCATCTGTTGATACGAGTGTCCCCTCGCCACCTGGACCCAACTGTCAACTGCTTGGG
GGA
GACCCCTTCTCACCTCTTCTATCCAACCAGTATCCTGTTCCCAGCCGTTTCTACCCCGACCTTCCAG
GC
CAGCCCAAGGATATGATCTCACAGCCTTACTGGCTGGGGACACCTCGGGAACACAGTTATGAAGCGGA
G
TTCCGAGCTGTGAGCATGAAGCCCACACTCCTACCCTCTGCCCCGGGGCCCACTGTGCCCTACTACCGG
GGC
CAAGACGTCCTGGCGCCTGGAGCTGGTTGGCCCGTGGCCCCTCAATACCCGCCCAAGATGAGCCCAG
CT
GGCTGGTTCCGGCCCATGCGAACTCTGCCCATGGACCCGGGCCTGGGATCCTCAGAGGAACAGGGCTC
C
TCCCCCTCGCTGTGGCCTGAGGTCACCTCCCTCCAGCCGGAGCCCAGCGACTCAGGACTAGGCGAAGGA
GAC
ACTAAGAGGAGGAGGATATCCCCCTATCCTTCCAGTGGCGACAGCTCCTCTCCCGCTGGGGCCCCTT
CT
CCTTTTGATAAGGAAACCGAAGGCCAGTTTTATAATTATTTTCCCAACTGA


Translation (530 aa):
MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAGSSLGTPYSGGALVPAAPGRF
L
GSFAYPPRAQVAGFPGPGEFFPPPAGAEGYPPVDGYPAPDPRAGLYPGPREDYALPAGLEVSGKLRVAL
S
NHLLWSKFNQHQTEMIITKQG
RRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAE
G
SMP
GNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPE
A
ACSASNTHVFTFQETQFIAVTAYQNAE
ITQLKIDNNPFAKGFRENFESMYASVDTSVPSPPGPNCQLLG
G
DPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYR
G
QDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGLGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEG
D
TKRRRISPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser