NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29077.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29077.1 Public Mus musculus 18 Dsc2 16 104 75 CCDS HistoryNCBI Gene:13506Re-query CCDS DB by CCDS ID:29077.1Re-query CCDS DB by GeneID:13506See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29077.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039247 ENSMUSP00000042905 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039247Link to Ensembl Protein Viewer:ENSMUSP00000042905Re-query CCDS DB by Nucleotide ID:ENSMUST00000039247Re-query CCDS DB by Protein ID:ENSMUSP00000042905
Original member Current member EBI,WTSI OTTMUST00000065335 OTTMUSP00000032550 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065335Link to Vega Protein Viewer:OTTMUSP00000032550Re-query CCDS DB by Nucleotide ID:OTTMUST00000065335Re-query CCDS DB by Protein ID:OTTMUSP00000032550
Original member Current member NCBI NM_013505.3 NP_038533.1 Accepted alive Link to Nucleotide Sequence:NM_013505.3Link to Protein Sequence:NP_038533.1Re-query CCDS DB by Nucleotide ID:NM_013505Re-query CCDS DB by Protein ID:NP_038533Link to BLink:NP_038533.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038533.1 848 P55292-2 848 100% 0 0

Chromosomal Locations for CCDS 29077.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 20032500 20032535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20033062 20033322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20034585 20034709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20035276 20035512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20038053 20038277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20041435 20041577 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20041697 20041953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20043726 20043911 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20044141 20044275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20045404 20045570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20046235 20046379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20047065 20047220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20048275 20048394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20050006 20050205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20051176 20051260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20059184 20059252 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2547 nt):
ATGGCGGCTGTGGGATCTATGCGCTCCGGGAGCCCTGCCTTCGGCCTGGGACACCTGTTGACCCTTGCGA
TC
CTTGCACTTGCCTCTGATGCCTGTAAAGAAGTCGTCCTCCAGGTCCCCTCTGAACTACCTGCCGAGAA
A
TTTGTTGGCAGAGTGAACCTGATGGACTGCCTTAAATCAGCAGACATAGTTCATCTGAGTGATCCTGAC
TTC
CAAGTCTTAGAAGATGGTTCTGTGTACACAACCAGTTCTGTTGTTTTGTCCTCGGGGCAAAGAAGCT
TT
ACTATATGGCTTTTTAGCACAGACAGCCAAGAAGAAAGGGAGATATCTGTCCATTTAGAGGGCCCAGT
A
GAGGTACTAAATAAAAGACCGCATACAGAGAAGGTTCTCAGCCGTGCCAAGAGAAGATGGGCTCCTATC
CCT
TGTTCCATGCTAGAGAATTCATTGGGTCCCTTCCCACTTTTCCTTCAACAGATCCAGTCTGACACAG
CT
CAAAACTATACCATATACTATTCCATCAGAGGTCCAGGAGTTGATAAAGAACCTCTAAACTTATTTTA
T
GTGGAAAGAGATACTGGAAACCTGTATTGCACTGGTCGTGTAGATCGTGAGCAGTATGAGTCCTTTGAG
CTG
ACTGCATTTGCAACAACTCCAGATGGGTATACGCCAGAGTACCCACTGCCGCTCCTCATTAAAATAG
AG
GACGAGAACGATAATTACCCGATCTTTACACAGAAACTGTACAGCTTCACAGTTCAGGAAAATAGTCG
C
ATTGGTTCTATTGTGGGGGAGGTCTGTGCAACCGACCTGGATGAGCCAGACACAATGCACACTCGCCTG
AGG
TACTCCATCCTGGAGCAGTCGCCTTCTCCACCCATGCTATTTACTATGCATCCCAGCACTGGTGTGA
TC
ACTACCACGTCGGCTCAGCTGGACAGAGAGTTAATTGACAAGTACCAGTTGCTAATAAAAGTCCAGGA
T
ATGGATGGCCAGTATTTTGGTTTGCACACAACAGCAAAGTGCATCATTACTATTGAAGATGTGAATGAC
AAC
CTGCCCACGTTCACTCGCACTACGTATGTGACATCAGTGGAAGAAAATACAGTTAATGTGGAAATCT
TG
CGACTTACTGTTCAGGATAAAGATTTAGTTAACTCACCTAATTGGAGAGCTAATTACACCATTTTGAA
G
GGCAATGAAAATGGAAATTTTAAAATCGTAACAGATCCTAAAACCAATGAAGGCATTCTGTGTGTGATT
AAG
CCTCTGGACTATGAAGAACGGCAACAGGTGACCCTGCAAATTGGAGTAGTTAATGAAGCTCCATACA
CT
AGAGAGGCTAGCTCAAAGTCACCCATGAGCACAGCCACAGTGACTGTCACCGTGACAAATCAGGATGA
G
GGCCCCGAGTGTATCCCTCCAATGCAAACTGTGAGGATTCAAGAAAATGTACCAGTTGGGACTAGAAAT
GAT
GGATATAAGGCATATGACCCAGAGACCAGAAGCAGCAGTGGCATAAGGTACAGAAAGTTAAGTGACC
CA
AGAGGGTGGGTCACTGTTAATGAAGATTCAGGATCGATCACTATTTTCCGAGCGTTGGATCGAGAGGC
T
GAGACTGTCAGAAATGGCATTTACAATATTACAGTCCTTGCGTTAGATGCAGATGGGAGAAGCTGTACT
GGA
ACTCTGGGAATCATACTTGAAGATGTGAATGATAATGGCCCATTCATACCCAAGCAGACAGTGGTGA
TA
TGCAAGGCTACCATGTCCTCTGCTGAAATTGTTGCAGTTGATCTCGATGATCCAGTGAATGGCCCACC
A
TTTGATTTCAGTTTGGAGAGCTCTGATTCGGAAGTTCAGAGGATGTGGAGGCTAACAAGAATCAATGAT
ACA
GCAGCTCGTCTTTCCTATCAGAACGACCCTTCATTTGGATCCTATGCAGTTCCCATTCGAGTTACAG
AC
AGACTTGGTCTGTCCTCAGTAACCACATTGAATGTCCTTGTATGTGACTGCATTACTGAAAGTGACTG
C
ACACTCCGCTCTGGAGAAAGGACTGGCTATGCTGATGTGAGACTTGGACCATGGGCCATCCTTGCTATA
CTG
TTGGGCATAGCCTTGCTATTTTGTATCCTGTTTACATTAGTCTGTAGTGTTTCCCGGGCATCAAAAC
AA
CAGAAAATTCTTCCTGATGACTTAGCTCAACAGAACCTAATTGTATCAAACACCGAGGCTCCTGGAGA
T
GACAAAGTTTATTCCACAAACGGCTTGACAACTCAAACTATGGGAGCTTCTGGGCAGACAGCTTTCACC
ACC
ATGGGAACTGGAGTCAAAAGTGGAGGGCAAGAGACCATTGAGATGGTAAAAGGAGGGCAGCAGACTT
TG
GACTCACGCAGAGGGGCTGGCTATCATCACCATACCCTGGATCCTTGCAGGGGAGGACATGTGGAGGT
G
GACAACTACAGACACACTTACTCAGAGTGGTACAATTTCATTCAGCCCCGACTTGGTGATGAAACCATT
AGA
GGACACACTCTGATTAAAAATTAA


Translation (848 aa):
MAAVGSMRSGSPAFGLGHLLTLAILALASDACKEVVLQVPSELPAEKFVGRVNLMDCLKSADIVHLSDPD
F
QVLEDGSVYTTSSVVLSSGQRSFTIWLFSTDSQEEREISVHLEGPVE
VLNKRPHTEKVLSRAKRRWAPI
P
CSMLENSLGPFPLFLQQ
IQSDTAQNYTIYYSIRGPGVDKEPLNLFYVERDTGNLYCTGRVDREQYESFE
L
TAFATTPDGYTPEYPLPLLIKIEDENDNYPIFTQKLYSFTVQENSRI
GSIVGEVCATDLDEPDTMHTRL
R
YSILEQSPSPPMLFTMHPSTGVITTTSAQLDRE
LIDKYQLLIKVQDMDGQYFGLHTTAKCIITIEDVND
N
LPTFTRTT
YVTSVEENTVNVEILRLTVQDKDLVNSPNWRANYTILKGNENGNFKIVTDPKTNEGILCVI
K
PLDYEERQQVTLQIGVVNEAPYTREASSKSPMSTATVTVTVTNQDEGPECIPPMQTVRIQENVPVGTRN
D
GYKAYDPETRSSSGI
RYRKLSDPRGWVTVNEDSGSITIFRALDREAETVRNGIYNITVLALDADGRSCT
G
TLGIILEDVNDNGPFIPKQTVVICKATMSSAEIVAVDLDDPVNGPPFDFSLESSDSEVQRMWRLTRIN
D
T
AARLSYQNDPSFGSYAVPIRVTDRLGLSSVTTLNVLVCDCITESDCTLRSGERTGYADVRLGPWAILAI
L
LGIALLF
CILFTLVCSVSRASKQQKILPDDLAQQNLIVSNTEAPGDDKVYSTNGLTTQTMGASGQTAFT
T
MGTGVKSGGQETIEMVKGGQQTLDSRRGAGYHHHTLDPCRGGHVEVDNYRHTYSEWYNFIQPRLGD
ETI
R
GHTLIKN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser