NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17604.1 Public Mus musculus 3 Sema6c 16 104 75 CCDS HistoryNCBI Gene:20360Re-query CCDS DB by CCDS ID:17604.1Re-query CCDS DB by GeneID:20360See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17604.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090821 ENSMUSP00000088331 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090821Link to Ensembl Protein Viewer:ENSMUSP00000088331Re-query CCDS DB by Nucleotide ID:ENSMUST00000090821Re-query CCDS DB by Protein ID:ENSMUSP00000088331
Original member Current member EBI,WTSI ENSMUST00000168321 ENSMUSP00000129081 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168321Link to Ensembl Protein Viewer:ENSMUSP00000129081Re-query CCDS DB by Nucleotide ID:ENSMUST00000168321Re-query CCDS DB by Protein ID:ENSMUSP00000129081
Original member Current member EBI,WTSI OTTMUST00000053084 OTTMUSP00000025222 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053084Link to Vega Protein Viewer:OTTMUSP00000025222Re-query CCDS DB by Nucleotide ID:OTTMUST00000053084Re-query CCDS DB by Protein ID:OTTMUSP00000025222
Original member Current member NCBI NM_011351.2 NP_035481.1 Accepted alive Link to Nucleotide Sequence:NM_011351.2Link to Protein Sequence:NP_035481.1Re-query CCDS DB by Nucleotide ID:NM_011351Re-query CCDS DB by Protein ID:NP_035481Link to BLink:NP_035481.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035481.1 931 Q9WTM3 931 100% 0 0

Chromosomal Locations for CCDS 17604.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 95164393 95164513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95167006 95167120 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95167413 95167476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95167624 95167680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95167999 95168100 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95168299 95168389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95168587 95168706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95168809 95168897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95169164 95169381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95169582 95169713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95169988 95170140 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95170318 95170491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95170751 95170897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95171173 95171250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95171334 95171389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95171558 95171602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 95172255 95173288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2796 nt):
ATGCCCCGTGCCCCCCACTCCATGCCCCTGCTGCTCCTGCTGCTGTTGCTGTCATCGCTCCCCCAAGCCC
AG
GCTGCCTTTCCCCAGGACCCCACCCCTCTGTTGACCTCTGACCTTCAAGGTGCCTCTCCATCATCCTG
G
TTCCGGGGCCTGGAGGACGATGCTGTGGCTGCGGAACTTGGGCTGGACTTTCAGAGATTCCTGACCTTG
AAC
CGGACCTTGCTTGTGGCTGCCCGGGATCACGTTTTCTCCTTCGATCTTCAAGCCCAAGAAGAAGGGG
AG
GGGCTGGTGCCCAACAAGTTTCTGACATGGAGGAGTCAAGATATGGAGAACTGTGCAGTCCGGGGAAA
G
CTGACGGACGAATGCTACAACTACATCCGTGTTCTTGTTCCCTGGAACTCGCAGACACTTCTTGCCTGT
GGA
ACAAATTCCTTCAGCCCTATGTGCCGCAGCTATGGGATAACATCTCTGCAACAGGAGGGTGAGGAGC
TG
AGTGGGCAGGCTCGATGCCCCTTTGATGCCACCCAGTCCACTGTGGCCATCTTTGCAGAGGGCAGTTT
G
TACTCAGCCACAGCAGCAGATTTCCAGGCCAGTGATGCTGTAGTTTACAGAAGTCTTGGACCTCAGCCT
CCA
CTCCGTTCTGCAAAGTATGACTCCAAGTGGCTTCGAGAGCCACACTTTGTCTATGCGTTGGAGCATG
GA
GAGCACGTCTACTTCTTCTTCCGAGAAGTCTCTGTGGAGGATGCCCGCTTAGGGAGGGTGCAGTTTTC
C
AGGGTAGCCCGGGTATGTAAACGTGACATGGGTGGCTCACCTCGGGCCTTGGATCGCCACTGGACATCC
TTC
CTTAAGCTGAGGCTCAACTGCTCTGTCCCTGGGGACTCTACCTTCTACTTTGACGTCTTACAGTCCT
TA
ACTGGGCCTGTGAACCTGCATGGCCGCTCCGCTCTCTTTGGGGTCTTCACTACTCAGACCAATAGCAT
T
CCTGGGTCTGCAGTCTGCGCCTTCTACCTAGATGATATTGAACGTGGCTTTGAGGGCAAGTTCAAGGAG
CAG
AGGAGTCTGGATGGGGCCTGGACTCCTGTGTCTGAGGACAAGGTCCCCTCACCCAGGCCAGGGTCCT
GT
GCAGGTGTGGGTGCAGCTGCCTCGTTCTCCTCCTCTCAAGACCTACCTGATGATGTCCTGCTCTTCAT
C
AAGGCACACCCGCTGCTGGATCCTGCTGTGCCACCCGCCACCCATCAACCGCTCCTCACTCTGACTAGC
AG
G
GCCCTGCTGACCCAGGTAGCTGTGGACGGAATGGCTGGTCCCCACAGAAATACTACTGTCCTGTTTC
TT
GGCTCCAACGATGGGACAGTGCTGAAGGTGCTACCTCCAGGGGGTCAGTCTTTGGGCTCTGAGCCTAT
C
GTCTTGGAAGAGATTGATGCCTACAGCCATGCCCGGTGCAGTGGGAAGCGGTCACCCCGAGCTGCGCGG
CGG
ATCATAGGGCTGGAGCTGGACACTGAGGGTCACAGGCTTTTTGTGGCCTTTCCTGGATGTATCGTCT
AC
CTCTCTCTCAGCCGGTGTGCCCGGCATGGAGCATGTCAGAGGAGCTGCCTGGCTTCTCTGGACCCATA
C
TGTGGATGGCATCGATCCAGAGGCTGCATGAGTATCAGGGGACCTGGTGGGACTGATGTCGATCTGACT
GGG
AACCAGGAATCCACAGAGCACGGTGACTGCCAAGATGGAGCGACCGGGAGTCAGTCTGGCCCTGGAG
AT
TCTGCTTATGGCGTGCGCAGGGACCTTTCCCCAGCCTCAGCCTCCCGATCCATTCCCATCCCACTCCT
C
CTGGCCTGTGTGGCCGCGGCCTTCGCTTTGGGCGCCTCAGTCTCCGGTCTCTTGGTGTCCTGTGCTTGT
CGT
CGCGCGAACCGCCGTCGGAGCAAGGACATCGAGACCCCGGGGCTGCCGCGCCCCCTCTCCCTTCGCA
GC
CTGGCCCGGCTGCACGGTGGCGGTCCTGAGCCCCCGCCTCCGCCCAAGGATGGAGATGCAGCGCAAAC
G
CCCCAGCTCTACACTACCTTCCTGCCTCCGCCCGACGGCGGATCCCCACCGGAGCTGGCCTGCCTACCC
ACG
CCGGAGACGACGCCCGAGCTGCCCGTGAAGCACCTCCGTGCCTCCGGGGGCCCCTGGGAATGGAACC
AG
AATGGGAACAACGCCTCGGAGGGCCCAGGCCGCCCACCACGGGGCTGCAGCGGGGCGGGCGGGCCCGC
A
CCGCGAGTGCTGGTGAGGCCACCGCCCCCTGGCTGCCCCGGGCAGGCGGTAGAGGTGACCACGCTGGAG
GAA
CTGCTGCGCTACCTGCACGGCCCTCAGCCGCCCAGGAAGGGTAGCGAACCTCTCGCCTCCGCCCCGT
TC
ACCTCCCGGCCGCCCGCCTCGGAGCCCGGCGCCTCGCTGTTCGTGGACTCCAGCCCGATGCCGCGGGA
T
GGCGTTCCGCCGCTCAGGCTCGACGTGCCACCCGAAGGCAAGCGCGCTGCCCCGAGCGGGCGGCCTGCT
CTC
TCGGCCCCAGCCCCGCGCCTGGGTGTCGGCGGCAGCCGCCGATTGCCCTTTCCCACACACCGGGCGC
CC
CCGGGCCTGCTCACGCGAGTGCCCTCGGGAGGCCCGGCCAGGTACTCCGGGGGGCCCGGGAGGCACCT
C
CTGTACCTGGGCCGGCCCGAAGGCCATCGCGGCCGCTCCCTGAAGAGGGTGGACGTGAAGTCTCCGCTG
TCG
CCCAAGCCGCCCCTCGCCTCCCCGCCGCAGCCCGCCCCGCACGGTGGTCATTTCAACTTCTGA


Translation (931 aa):
MPRAPHSMPLLLLLLLLSSLPQAQAAFPQDPTPLLTSDLQGASPSSWFRGLEDDAVAAELGLDFQRFLTL
N
RTLLVAA
RDHVFSFDLQAQEEGEGLVPNKFLTWRSQDMENCAVRGKLTDECYNYIRVLVPWNSQTLLAC
G
TNSFSPMCRSYG
ITSLQQEGEELSGQARCPFDATQSTVAIFAEGSLYSATAADFQASDAVVYRSLGPQP
P
LRSAKYDSKWLR
EPHFVYALEHGEHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTS
F
LKLRLNCSVPGDSTFYFDVLQSLTGPVNLHGRSALFGVFTTQTN
SIPGSAVCAFYLDDIERGFEGKFKE
Q
RSLDGAWTPVSEDKVPSP
RPGSCAGVGAAASFSSSQDLPDDVLLFIKAHPLLDPAVPPATHQPLLTLTS
R
ALLTQVAVDGMAGPHRNTTVLFLGSNDGTVLKVLPPGGQSLGSEPIVLEEIDAYSHARCSGKRSPRAAR
R
IIGLELDTEGHRLFVAFPGCIVYLSLSRCARHGACQ
RSCLASLDPYCGWHRSRGCMSIRGPGGTDVDLT
G
NQESTEHGDCQ
DGATGSQSGPGDSAYGVRRDLSPASASRSIPIPLLLACVAAAFALGASVSGLLVSCAC
R
RANRRRSKDIETPGLPRPLSLRSLARLHGGGPEPPPPPKDGDAAQTPQLYTTFLPPPDGGSPPELACLP
T
PETTPELPVKHLRASGGPWEWNQNGNNASEGPGRPPRGCSGAGGPAPRVLVRPPPPGCPGQAVEVTTLE
E
LLRYLHGPQPPRKGSEPLASAPFTSRPPASEPGASLFVDSSPMPRDGVPPLRLDVPPEGKRAAPSGRPA
L
SAPAPRLGVGGSRRLPFPTHRAPPGLLTRVPSGGPARYSGGPGRHLLYLGRPEGHRGRSLKRVDVKSPL
S
PKPPLASPPQPAPHGGHFNF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser