NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25507.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25507.1 Public Mus musculus 11 Gfap 16 104 75 CCDS HistoryNCBI Gene:14580Re-query CCDS DB by CCDS ID:25507.1Re-query CCDS DB by GeneID:14580

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25507.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000067444 ENSMUSP00000064691 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067444Link to Ensembl Protein Viewer:ENSMUSP00000064691Re-query CCDS DB by Nucleotide ID:ENSMUST00000067444Re-query CCDS DB by Protein ID:ENSMUSP00000064691
Original member Current member EBI,WTSI OTTMUST00000006346 OTTMUSP00000002989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000006346Link to Vega Protein Viewer:OTTMUSP00000002989Re-query CCDS DB by Nucleotide ID:OTTMUST00000006346Re-query CCDS DB by Protein ID:OTTMUSP00000002989
Original member Current member NCBI NM_010277.3 NP_034407.2 Accepted alive Link to Nucleotide Sequence:NM_010277.3Link to Protein Sequence:NP_034407.2Re-query CCDS DB by Nucleotide ID:NM_010277Re-query CCDS DB by Protein ID:NP_034407Link to BLink:NP_034407.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034407.2 430 P03995-1 430 100% 0 0

Chromosomal Locations for CCDS 25507.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 102888677 102888721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102889435 102889520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102891911 102891954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102893035 102893255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102893461 102893586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102894378 102894539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102895473 102895568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102895750 102895810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 102896666 102897117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1293 nt):
ATGGAGCGGAGACGCATCACCTCTGCGCGCCGCTCCTATGCCTCCGAGACGGTGGTCAGGGGCCTCGGTC
CT
AGTCGACAACTGGGTACCATGCCACGCTTCTCCTTGTCTCGAATGACTCCTCCACTCCCTGCCAGGGT
G
GACTTCTCCCTGGCCGGGGCGCTCAATGCTGGCTTCAAGGAGACACGGGCGAGCGAGCGTGCAGAGATG
ATG
GAGCTCAATGACCGCTTTGCTAGCTACATCGAGAAGGTCCGCTTCCTGGAACAGCAAAACAAGGCGC
TG
GCAGCTGAACTGAACCAGCTTCGAGCCAAGGAGCCCACCAAACTGGCTGATGTCTACCAGGCGGAGCT
T
CGGGAGCTGCGGCTGCGGCTGGACCAGCTTACGGCCAACAGTGCCCGGCTGGAGGTGGAGAGGGACAAC
TTT
GCACAGGACCTCGGCACCCTGAGGCAGAAGCTCCAAGATGAAACCAACCTGAGGCTGGAGGCAGAGA
AC
AACCTGGCTGCGTATAGACAGGAGGCAGATGAAGCCACCCTGGCTCGTGTGGATTTGGAGAGAAAGGT
T
GAATCGCTGGAGGAGGAGATCCAGTTCTTAAGGAAGATCTATGAGGAGGAAGTTCGAGAACTCCGGGAG
CAG
CTGGCCCAACAGCAGGTCCACGTGGAGATGGATGTGGCCAAGCCAGACCTCACAGCGGCCCTGAGAG
AG
ATTCGCACTCAATACGAGGCAGTGGCCACCAGTAACATGCAAGAGACAGAGGAGTGGTATCGGTCTAA
G
TTTGCAGACCTCACAGACGCTGCGTCCCGCAACGCAGAGCTGCTCCGCCAAGCCAAGCACGAAGCTAAC
GAC
TATCGCCGCCAACTGCAGGCCTTGACCTGCGATCTGGAGTCCCTGCGCGGCACGAACGAGTCCCTAG
AG
CGGCAAATGCGCGAACAGGAAGAGCGCCATGCGCGGGAGTCGGCCAGTTACCAGGAGGCACTTGCTCG
G
CTGGAGGAGGAGGGCCAAAGCCTCAAGGAGGAGATGGCCCGCCACCTGCAGGAGTACCAGGATCTACTC
AAC
GTTAAGCTAGCCCTGGACATCGAGATCGCCACCTACAGGAAATTGCTGGAGGGCGAAGAAAACCGCA
TC
ACCATTCCTGTACAGACTTTCTCCAACCTCCAGATCCGAGAAACCAGCCTGGACACCAAATCCGTGTC
A
GAAGGCCACCTCAAGAGGAACATCGTGGTAAAGACTGTGGAGATGCGGGATGGTGAGGTCATTAAGGAC
TCG
AAGCAGGAGCACAAGGACGTGGTGATGTGA


Translation (430 aa):
MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGALNAGFKETRASERAEM
M
ELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDN
F
AQDLGTLRQ
KLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELRE
Q
LAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSK
FADLTDAASRNAELLRQAKHEAN
D
YRRQLQALTCDLESLRGT
NESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLL
N
VKLALDIEIATYRKLLEGEEN
RITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKD
S
KQEHKDVVM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser