NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21661.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21661.1 Public Mus musculus 7 Tpp1 16 104 75 CCDS HistoryNCBI Gene:12751Re-query CCDS DB by CCDS ID:21661.1Re-query CCDS DB by GeneID:12751

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21661.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033184 ENSMUSP00000033184 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033184Link to Ensembl Protein Viewer:ENSMUSP00000033184Re-query CCDS DB by Nucleotide ID:ENSMUST00000033184Re-query CCDS DB by Protein ID:ENSMUSP00000033184
Original member Current member NCBI NM_009906.5 NP_034036.1 Accepted alive Link to Nucleotide Sequence:NM_009906.5Link to Protein Sequence:NP_034036.1Re-query CCDS DB by Nucleotide ID:NM_009906Re-query CCDS DB by Protein ID:NP_034036Link to BLink:NP_034036.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034036.1 562 O89023 562 100% 0 0

Chromosomal Locations for CCDS 21661.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

Chromosome Start Stop Links
7 105746632 105746772 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105746943 105747068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105747387 105747545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105747659 105747779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105748582 105748651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105748883 105749071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105749225 105749423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105749537 105749712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105749860 105749987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105750180 105750330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105751590 105751729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105751982 105752053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105752171 105752187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1689 nt):
ATGGGACTCCAAGCCCGCCTCCTAGGGCTCCTTGCTCTCGTCATCGCCGGCAAATGCACTTACAACCCTG
AG
CCGGACCAGCGGTGGATGCTGCCTCCAGGCTGGGTGTCCCTGGGCCGCGTGGATCCCGAGGAAGAGCT
G
AGTCTCACTTTTGCGCTGAAACAGCGGAACCTGGAAAGACTCTCGGAGCTGGTGCAGGCTGTGTCGGAT
CCT
AGCTCTCCTCAATATGGAAAGTACCTAACCCTGGAGGATGTAGCTGAGCTGGTTCAACCATCACCCC
TG
ACCCTCCTCACTGTCCAAAAGTGGCTCTCAGCAGCTGGAGCCCGGAACTGCGATTCAGTGACCACCCA
G
GACTTTCTGACTTGCTGGCTGAGTGTCCGACAGGCTGAGCTGCTGCTCCCAGGAGCTGAGTTTCATCGC
TAT
GTAGGGGGACCTACAAAGACCCATGTTATAAGGTCCCCACATCCCTACCAGCTTCCCCAGGCCTTGG
CC
CCTCATGTGGATTTTGTGGGGGGGCTGCACCGTTTCCCCCCTTCATCTCCAAGACAACGTCCAGAACC
A
CAACAGGTAGGAACTGTTAGCCTGCACTTGGGAGTGACTCCGTCTGTGCTCCGTCAGCGATACAACCTG
ACA
GCCAAAGATGTGGGCTCAGGCACCACCAACAATAGCCAGGCCTGTGCCCAGTTCCTGGAACAGTACT
TC
CATAACTCGGATCTGACTGAGTTCATGCGCCTATTCGGTGGCAGTTTTACACACCAGGCCTCAGTAGC
A
AAAGTTGTTGGAAAGCAAGGGCGAGGCCGAGCTGGGATCGAGGCCAGTCTAGATGTGGAATACCTGATG
AGT
GCTGGTGCCAATATCTCCACTTGGGTCTACAGTAGCCCTGGCCGCCATGAGGCACAGGAGCCCTTCT
TA
CAATGGCTCCTGCTTCTTAGCAATGAGTCATCTTTGCCACATGTACATACTGTGAGTTACGGAGACGA
T
GAAGACTCCCTCAGCAGCATCTACATCCAGAGAGTCAACACTGAGTTCATGAAGGCTGCTGCTCGGGGT
CTC
ACCCTCCTTTTTGCCTCAGGTGACACTGGAGCTGGGTGTTGGTCTGTCTCCGGAAGACACAAGTTCC
GC
CCTAGCTTCCCTGCTTCCAGCCCCTATGTTACTACAGTTGGAGGAACCTCCTTCAAGAATCCTTTCCT
C
ATCACAGATGAAGTAGTTGACTATATCAGTGGTGGAGGCTTCAGCAATGTTTTCCCACGGCCTCCCTAC
CAG
GAGGAAGCAGTGGCCCAGTTCTTGAAATCCAGCTCTCATCTACCACCATCCAGTTACTTCAATGCTA
GT
GGCCGTGCCTACCCAGATGTTGCCGCACTATCTGATGGCTACTGGGTGGTCAGCAACATGGTCCCCAT
T
CCATGGGTATCTGGAACCTCGGCCTCTACTCCAGTGTTTGGGGGAATTTTATCCTTGATAAATGAGCAC
AGA
ATCCTCAATGGCCGCCCTCCTCTTGGCTTTCTCAACCCCAGGCTCTATCAGCAGCATGGGACAGGAC
TC
TTTGATGTAACCCACGGCTGCCATGAGTCCTGTCTGAATGAAGAAGTGGAGGGTCAGGGTTTCTGCTC
T
GGTCCTGGCTGGGATCCTGTGACAGGTTGGGGAACACCCAACTTCCCAGCCCTACTGAAGACCCTGCTC
AAC
CCTTGA


Translation (562 aa):
MGLQARLLGLLALVIAGKCTYNPEPDQRWMLPPGWVSLGRVDPEEELSLTFALKQRNLERLSELVQAVSD
P
SSPQY
GKYLTLEDVAELVQPSPLTLLTVQKWLSAAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHR
Y
VGGPTKTHVIRSPHPYQLPQALAPHVDF
VGGLHRFPPSSPRQRPEPQQVGTVSLHLGVTPSVLRQRYNL
T
AKDVGSGTTNNSQACAQ
FLEQYFHNSDLTEFMRLFGGSFTHQASVAKVVGKQGRGRAGIEASLDVEYLM
S
AGANISTWVYSSP
GRHEAQEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSIYIQRVNTEFMKAAARG
L
TLLFAS
GDTGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLITDEVVDYISGGGFSNVFPRPPY
Q
EEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGYWVVSNMVPIPWVSGTSASTPVFGGILSLINEH
R
ILNGRPPLGFLNPRLYQQHGTGLFD
VTHGCHESCLNEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLL
N
P




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser