NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41173.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41173.1 Public Mus musculus X Alas2 16 104 75 CCDS HistoryNCBI Gene:11656Re-query CCDS DB by CCDS ID:41173.1Re-query CCDS DB by GeneID:11656See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 41173.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000066337 ENSMUSP00000066040 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066337Link to Ensembl Protein Viewer:ENSMUSP00000066040Re-query CCDS DB by Nucleotide ID:ENSMUST00000066337Re-query CCDS DB by Protein ID:ENSMUSP00000066040
Original member Current member EBI,WTSI OTTMUST00000045893 OTTMUSP00000020679 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045893Link to Vega Protein Viewer:OTTMUSP00000020679Re-query CCDS DB by Nucleotide ID:OTTMUST00000045893Re-query CCDS DB by Protein ID:OTTMUSP00000020679
Original member Current member NCBI NM_009653.3 NP_033783.1 Accepted alive Link to Nucleotide Sequence:NM_009653.3Link to Protein Sequence:NP_033783.1Re-query CCDS DB by Nucleotide ID:NM_009653Re-query CCDS DB by Protein ID:NP_033783Link to BLink:NP_033783.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033783.1 587 P08680 587 100% 0 0

Chromosomal Locations for CCDS 41173.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 150552164 150552344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150552959 150553081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150553933 150554043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150557186 150557408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150557939 150558123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150560734 150560913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150563761 150563925 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150565007 150565275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150566501 150566663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 150570328 150570491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1764 nt):
ATGGTGGCAGCAGCTATGTTGCTACGGTCCTGTCCAGTGCTCTCTCAGGGCCCCACAGGCCTCCTGGGCA
AA
GTGGCTAAAACCTACCAGTTCCTATTTAGTATTGGACGCTGCCCCATCCTGGCCACTCAAGGACCAAC
C
TGTTCTCAAATCCATCTTAAGGCAACCAAGGCTGGAGGAGACTCTCCATCTTGGGCTAAGAGCCATTGT
CCT
TTCATGCTGTCAGAACTCCAAGACAGGAAGAGCAAGATTGTGCAGAGGGCAGCTCCAGAAGTTCAAG
AG
GATGTCAAGACTTTCAAGACAGACCTGCTGAGCACCATGGATTCAACCACCCGAAGCCATTCATTTCC
T
AGTTTCCAGGAGCCAGAGCAGACTGAAGGGGCAGTTCCCCACCTGATTCAGAACAATATGACTGGAAGC
CAG
GCTTTCGGTTATGACCAATTTTTCAGAGACAAGATCATGGAGAAGAAACAGGACCACACCTACCGTG
TG
TTCAAGACTGTGAATCGTTGGGCTAATGCCTACCCCTTTGCCCAACACTTCTCCGAGGCATCTATGGC
A
TCAAAGGATGTTTCTGTTTGGTGTAGTAATGACTATTTGGGCATAAGCAGACACCCTCGTGTCTTGCAG
GCC
ATAGAGGAGACCCTGAAGAATCATGGAGCTGGAGCTGGGGGCACTCGCAATATCTCAGGTACCAGCA
AG
TTTCATGTGGAGCTTGAACAGGAGCTGGCTGAACTACACCAGAAAGACTCAGCTCTGCTCTTCTCCTC
C
TGTTTTGTGGCCAATGATTCTACTCTCTTTACACTGGCCAAGCTTCTGCCAGGGTGTGAGATCTACTCA
GAT
GCAGGCAATCATGCCTCCATGATCCAAGGCATTCGCAACAGTGGTGCAGCCAAGTTTGTCTTCAGAC
AC
AATGACCCAGGCCACCTGAAGAAACTTCTCGAGAAGTCTGATCCCAAGACACCAAAAATTGTGGCTTT
T
GAGACTGTTCATTCCATGGATGGTGCCATCTGTCCTCTGGAGGAATTGTGTGATGTGGCCCACCAGTAT
GGA
GCCCTGACCTTCGTAGATGAAGTCCATGCTGTAGGACTGTATGGAGCCCGGGGTGCAGGTATCGGGG
AG
CGTGATGGAATTATGCACAAGCTTGACATCATCTCTGGAACTCTTGGCAAGGCCTTTGGTTGCGTCGG
T
GGCTATATAGCCAGCACTCGGGACTTGGTGGACATGGTGCGCTCCTACGCTGCAGGCTTCATCTTTACC
ACT
TCACTGCCTCCCATGGTGCTCTCTGGGGCTCTAGAATCTGTGCGCCTACTCAAGGGAGAGGAGGGTC
AA
GCCCTGAGGCGGGCACACCAGCGCAATGTCAAACACATGCGCCAGCTGCTAATGGACAGGGGCTTTCC
T
GTTATCCCCTGTCCCAGCCACATCATCCCCATCAGGGTGGGTAATGCAGCACTCAACAGCAAGATCTGT
GAT
CTTCTGCTCTCCAAGCACAGCATCTATGTGCAGGCCATCAACTACCCAACTGTGCCTCGTGGTGAGG
AG
CTACTGCGCTTGGCCCCCTCCCCCCACCACAGCCCTCAGATGATGGAAAACTTTGTGGAGAAGCTGCT
G
CTGGCCTGGACTGAGGTGGGGCTGCCCCTCCAAGATGTGTCTGTGGCTGCATGCAACTTCTGTCATCGT
CCT
GTGCACTTTGAACTTATGAGCGAGTGGGAGCGATCCTACTTTGGGAACATGGGACCCCAATATGTTA
CC
ACCTATGCTTAA


Translation (587 aa):
MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQGPTCSQIHLKATKAGGDSPSWAKSHC
P
FMLSELQDRKSKIVQRAAPEVQEDVKTFKT
DLLSTMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGS
Q
AFGYDQFFRDKIMEKKQDHTYRVFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQ
A
I
EETLKNHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYS
D
AGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMD
GAICPLEELCDVAHQY
G
ALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTL
GKAFGCVGGYIASTRDLVDMVRSYAAGFIFT
T
SLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGFPVIPCPSHIIPIR
VGNAALNSKIC
D
LLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHSPQMMENFV
EKLLLAWTEVGLPLQDVSVAACNFCHR
P
VHFELMSEWERSYFGNMGPQYVTTYA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser