NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18526.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18526.1 Public Mus musculus 4 Ptch2 16 104 75 CCDS HistoryNCBI Gene:19207Re-query CCDS DB by CCDS ID:18526.1Re-query CCDS DB by GeneID:19207See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18526.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030443 ENSMUSP00000030443 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030443Link to Ensembl Protein Viewer:ENSMUSP00000030443Re-query CCDS DB by Nucleotide ID:ENSMUST00000030443Re-query CCDS DB by Protein ID:ENSMUSP00000030443
Original member Current member EBI,WTSI OTTMUST00000023049 OTTMUSP00000010515 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000023049Link to Vega Protein Viewer:OTTMUSP00000010515Re-query CCDS DB by Nucleotide ID:OTTMUST00000023049Re-query CCDS DB by Protein ID:OTTMUSP00000010515
Original member Current member NCBI NM_008958.2 NP_032984.1 Accepted alive Link to Nucleotide Sequence:NM_008958.2Link to Protein Sequence:NP_032984.1Re-query CCDS DB by Nucleotide ID:NM_008958Re-query CCDS DB by Protein ID:NP_032984Link to BLink:NP_032984.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032984.1 1182 O35595 1182 100% 0 0

Chromosomal Locations for CCDS 18526.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 117096356 117096427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117096847 117097039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117104733 117104922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117105030 117105099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117105234 117105325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117105935 117106130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117107899 117108020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117108155 117108302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117108383 117108514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117108604 117108759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117108856 117108948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117109293 117109418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117109512 117109630 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117109737 117110085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117110195 117110507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117110599 117110741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117110827 117111007 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117111125 117111405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117111515 117111652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117114012 117114154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117114243 117114342 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117114640 117114831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3549 nt):
ATGGTTCGGCCACTGTCCCTTGGAGAGCTACCTCCCAGCTACACACCTCCAGCTCGGTCCTCCGCACCTC
AT
ATCCTAGCTGGGAGCCTGCAGGCTCCTCTCTGGCTTCGAGCTTACTTCCAAGGTCTACTCTTCTCCCT
G
GGGTGCAGGATCCAGAAACACTGCGGCAAAGTGCTCTTCCTGGGACTGGTGGCCTTTGGGGCTCTGGCA
CTG
GGTCTCCGAGTGGCTGTAATTGAGACAGACCTAGAACAGCTCTGGGTAGAAGTGGGCAGCAGGGTGA
GC
CAGGAGCTGCACTACACCAAGGAGAAGCTGGGGGAAGAGGCTGCGTACACCTCCCAGATGTTGATTCA
G
ACTGCGCACCAGGAAGGGGGAAACGTCCTCACCCCCGAGGCACTTGACTTGCACCTCCAGGCGGCGCTC
ACT
GCCAGTAAAGTCCAAGTATCACTCTATGGGAAATCCTGGGATTTGAACAAGATCTGCTACAAATCAG
GG
GTTCCCCTTATTGAAAATGGGATGATCGAGCGGATGATTGAGAAGCTGTTTCCCTGTGTGATCCTCAC
C
CCGCTTGACTGCTTCTGGGAAGGAGCCAAACTCCAAGGGGGCTCTGCCTACTTGCCGGGCCGCCCTGAT
ATC
CAGTGGACCAACCTGGACCCTCAGCAGCTGCTCGAGGAGCTGGGCCCCTTTGCCTCTCTGGAGGGCT
TC
CGGGAACTGCTAGATAAGGCACAGGTGGGCCAGGCCTATGTGGGGCGACCCTGTCTGGACCCTGATGA
C
CCCCACTGTCCACCTAGTGCTCCCAACCGGCACAGCAGGCAGGCTCCCAATGTGGCTCAGGAGCTGAGT
GGG
GGCTGCCATGGCTTCTCCCACAAGTTCATGCACTGGCAGGAGGAACTGCTACTAGGGGGCACAGCCA
GA
GATCTCCAAGGACAGCTGCTGAGGGCAGAGGCCTTGCAGAGCACCTTCCTGCTCATGAGTCCCCGTCA
G
CTGTACGAGCACTTCCGGGGCGACTACCAGACACATGACATCGGCTGGAGCGAGGAGCAGGCCAGCATG
GTG
CTGCAGGCCTGGCAGAGGCGCTTTGTGCAGCTAGCCCAGGAGGCTCTGCCGGCCAACGCGTCCCAGC
AG
ATCCATGCCTTCTCCTCCACCACCCTGGATGACATCCTGCGCGCGTTCTCTGAAGTCAGCACCACCCG
T
GTGGTAGGAGGCTATCTGCTTATGCTGGCCTATGCCTGCGTAACAATGCTGCGGTGGGACTGCGCCCAG
TCC
CAGGGTGCCGTAGGTCTTGCTGGGGTGTTGCTGGTGGCCCTGGCGGTGGCCTCAGGTCTTGGGCTTT
GT
GCCCTACTTGGCATCACTTTCAATGCTGCCACTACACAGGTGCTGCCCTTCTTGGCTCTGGGCATTGG
C
GTGGATGACATCTTCCTGCTGGCGCATGCCTTCACAAAAGCCCCACCTGACACCCCTCTCCCAGAGCGT
ATG
GGTGAGTGTTTGAGGAGCACGGGCACCAGCGTGGCACTCACATCCGTCAACAACATGGTCGCCTTTT
TC
ATGGCTGCCCTGGTTCCCATTCCTGCGCTGCGGGCCTTCTCCCTGCAGGCAGCCATAGTGGTCGGCTG
C
AACTTTGCAGCGGTAATGCTCGTCTTCCCTGCCATCCTCAGCCTCGACCTGCGCCGGCGCCACCGCCAA
CGC
CTGGACGTTCTCTGCTGCTTTTCTAGCCCCTGCTCCGCTCAGGTCATTCAGATGCTGCCCCAGGAGC
TA
GGGGACAGAGCAGTACCAGTGGGCATTGCCCACCTGACTGCCACCGTGCAAGCCTTCACCCACTGCGA
A
GCCAGCAGCCAGCATGTAGTCACCATTTTGCCTCCTCAAGCCCACCTGCTGTCTCCAGCTTCTGACCCA
CTG
GGCTCCGAACTCTATAGCCCTGGAGGGTCTACACGGGACCTTCTCAGTCAGGAGGAGGGGACAGGGC
CA
CAGGCGGCCTGCAGGCCCCTGCTCTGTGCCCACTGGACTCTCGCCCATTTTGCCCGCTATCAGTTTGC
A
CCTTTACTGCTCCAGACACGAGCCAAGGCCCTGGTGTTGCTGTTCTTTGGGGCTCTTTTGGGCCTGAGC
CTC
TATGGAGCCACCTTGGTACAAGATGGGCTGGCCCTGACAGATGTGGTCCCTAGGGGCACCAAGGAAC
AT
GCTTTCCTGAGCGCCCAGCTCAGGTACTTCTCCCTGTACGAGGTGGCTCTAGTGACACAGGGTGGCTT
T
GACTACGCCCACTCCCAACGCGCCCTCTTTGATCTGCACCAGCGCTTCAGCTCCCTCAAGGCTGTGCTG
CCC
CCACCTGCCACCCAGGCACCCCGCACCTGGCTTCACTACTACCGCAGCTGGCTACAGGGTATCCAGG
CT
GCATTTGACCAAGACTGGGCTTCTGGGCGCATCACCTGCCACTCTTACCGCAACGGCTCAGAAGATGG
C
GCCCTGGCCTACAAGCTGCTCATCCAAACCGGGAATGCCCAGGAGCCTCTGGATTTCAGCCAGCTGACC
ACA
AGGAAACTGGTGGACAAGGAGGGACTCATTCCCCCAGAGCTCTTCTACATGGGGCTAACCGTGTGGG
TG
AGCAGCGACCCCCTGGGCCTCGCAGCCTCTCAGGCCAACTTCTACCCCCCACCTCCAGAGTGGCTTCA
C
GACAAATATGATACCACCGGGGAGAACCTTCGCATCCCGGCAGCCCAGCCCTTGGAGTTTGCCCAGTTC
CCC
TTCCTGCTGCATGGACTCCAGAAGACTGCAGACTTTGTAGAAGCCATCGAAGGGGCCAGGGCGGCAT
GC
ACAGAGGCAGGCCAGGCAGGGGTGCATGCCTACCCCAGTGGCTCCCCCTTCCTCTTCTGGGAGCAGTA
T
CTGGGTCTTCGGCGCTGCTTCCTGCTGGCAGTCTGCATCTTGCTGGTGTGCACCTTCCTCGTCTGTGCC
CTG
CTTCTACTCAGCCCGTGGACAGCTGGCCTCATAGTGCTGGTCCTGGCAATGATGACTGTGGAGCTCT
TT
GGTATCATGGGATTCCTGGGCATCAAACTGAGTGCCATCCCCGTGGTAATCCTCGTGGCCTCTATAGG
C
ATTGGTGTTGAATTCACAGTTCACGTGGCTCTGGGCTTCCTGACCAGCCATGGTAGCCGGAACCTGCGG
GCT
GCTAGCGCTCTGGAACAGACCTTTGCCCCTGTGACTGATGGAGCTGTCTCCACCTTGCTGGGTCTGC
TC
ATGCTTGCTGGTTCTAACTTTGACTTCATCATAAGGTATTTCTTTGTGGTGCTGACGGTGCTGACACT
C
TTGGGCCTGCTCCATGGACTCCTGCTGCTGCCTGTGCTGCTCTCTATCCTAGGCCCCCCGCCACAGGTG
GTG
CAGGTATACAAGGAGAGTCCACAGACCCTAAACTCCGCTGCTCCACAGAGAGGTGGGCTCAGGTGGG
AC
AGGCCCCCCACCCTGCCCCAGAGTTTTGCCAGAGTGACTACCTCCATGACTGTGGCCCTCCACCCACC
A
CCTCTGCCTGGAGCATACGTCCACCCAGCCTCCGAGGAGCCCACATAG


Translation (1182 aa):
MVRPLSLGELPPSYTPPARSSAPHILAGSLQAPLWLRAYFQGLLFSLGCRIQKHCGKVLFLGLVAFGALA
L
GLRVAVIETDLEQLWVE
VGSRVSQELHYTKEKLGEEAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAAL
T
ASKVQVSLYG
KSWDLNKICYKSGVPLIENGMIERMIEKLFPCVILTPLDCFWEGAKLQGGSAYLPGRPD
I
QWTNLDPQQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQ
APNVAQELS
G
GCHGFSHKFMHWQEELLLGGTARDLQGQLL
RAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASM
V
LQAWQRRFVQ
LAQEALPANASQQIHAFSSTTLDDILRAFSEVSTTRVVGGYLLMLAYACVTMLRWDCAQ
S
QGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQ
VLPFLALGIGVDDIFLLAHAFTKAPPDTPLPER
M
GECLRSTGTSVALTSVNNMVAFFMAALVPIPALRAFSLQ
AAIVVGCNFAAVMLVFPAILSLDLRRRHRQ
R
LDVLCCFS
SPCSAQVIQMLPQELGDRAVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHLLSPASDP
L
GSELYSPGGSTRDLLSQEEGTGPQAACRPLLCAHWTLAHFARYQFAPLLLQTRAK
ALVLLFFGALLGLS
L
YGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVL
P
PPATQAPRTWLHYYRSWLQ
GIQAAFDQDWASGRITCHSYRNGSEDGALAYKLLIQTGNAQEPLDFSQLT
T
RKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLR
IPAAQPLEFAQF
P
FLLHGLQKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCA
L
LLLSPWTAGLI
VLVLAMMTVELFGIMGFLGIKLSAIPVVILVASIGIGVEFTVHVALGFLTSHGSRNLR
A
ASALEQTFAPVTDGAVSTLLGLLMLAGSNFDFII
RYFFVVLTVLTLLGLLHGLLLLPVLLSILGPPPQV
V
QVYKESPQTLNSAAPQRGGLRWDRPPTLPQSFARVTTSMTVALHPPPLPGAYVHPASEEPT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser