NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57181.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57181.1 Public Mus musculus 2 Pax6 16 104 75 CCDS HistoryNCBI Gene:18508Re-query CCDS DB by CCDS ID:57181.1Re-query CCDS DB by GeneID:18508

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57181.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090397 ENSMUSP00000087878 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090397Link to Ensembl Protein Viewer:ENSMUSP00000087878Re-query CCDS DB by Nucleotide ID:ENSMUST00000090397Re-query CCDS DB by Protein ID:ENSMUSP00000087878
Original member Current member EBI,WTSI ENSMUST00000111082 ENSMUSP00000106711 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111082Link to Ensembl Protein Viewer:ENSMUSP00000106711Re-query CCDS DB by Nucleotide ID:ENSMUST00000111082Re-query CCDS DB by Protein ID:ENSMUSP00000106711
Original member Current member EBI,WTSI ENSMUST00000111083 ENSMUSP00000106712 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111083Link to Ensembl Protein Viewer:ENSMUSP00000106712Re-query CCDS DB by Nucleotide ID:ENSMUST00000111083Re-query CCDS DB by Protein ID:ENSMUSP00000106712
Original member Current member EBI,WTSI ENSMUST00000111087 ENSMUSP00000106716 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111087Link to Ensembl Protein Viewer:ENSMUSP00000106716Re-query CCDS DB by Nucleotide ID:ENSMUST00000111087Re-query CCDS DB by Protein ID:ENSMUSP00000106716
Original member Current member EBI,WTSI OTTMUST00000035641 OTTMUSP00000015973 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035641Link to Vega Protein Viewer:OTTMUSP00000015973Re-query CCDS DB by Nucleotide ID:OTTMUST00000035641Re-query CCDS DB by Protein ID:OTTMUSP00000015973
Original member Current member EBI,WTSI OTTMUST00000035646 OTTMUSP00000015976 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035646Link to Vega Protein Viewer:OTTMUSP00000015976Re-query CCDS DB by Nucleotide ID:OTTMUST00000035646Re-query CCDS DB by Protein ID:OTTMUSP00000015976
Original member Current member EBI,WTSI OTTMUST00000035648 OTTMUSP00000015978 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035648Link to Vega Protein Viewer:OTTMUSP00000015978Re-query CCDS DB by Nucleotide ID:OTTMUST00000035648Re-query CCDS DB by Protein ID:OTTMUSP00000015978
Original member Current member EBI,WTSI OTTMUST00000035649 OTTMUSP00000015979 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035649Link to Vega Protein Viewer:OTTMUSP00000015979Re-query CCDS DB by Nucleotide ID:OTTMUST00000035649Re-query CCDS DB by Protein ID:OTTMUSP00000015979
Original member Current member NCBI NM_001244201.1 NP_001231130.1 Accepted alive Link to Nucleotide Sequence:NM_001244201.1Link to Protein Sequence:NP_001231130.1Re-query CCDS DB by Nucleotide ID:NM_001244201Re-query CCDS DB by Protein ID:NP_001231130Link to BLink:NP_001231130.1
Original member Current member NCBI NM_001244202.1 NP_001231131.1 Accepted alive Link to Nucleotide Sequence:NM_001244202.1Link to Protein Sequence:NP_001231131.1Re-query CCDS DB by Nucleotide ID:NM_001244202Re-query CCDS DB by Protein ID:NP_001231131Link to BLink:NP_001231131.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001231130.1 422 P63015-1 422 100% 0 0
NP_001231131.1 422 P63015-1 422 100% 0 0

Chromosomal Locations for CCDS 57181.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 105680298 105680307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105683828 105683958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105684887 105685102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105685778 105685943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105691565 105691723 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105692194 105692276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105692470 105692620 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105692737 105692852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105695306 105695456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 105696270 105696355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGCAGAACAGTCACAGCGGAGTGAATCAGCTTGGTGGTGTCTTTGTCAACGGGCGGCCACTGCCGGACT
CC
ACCCGGCAGAAGATCGTAGAGCTAGCTCACAGCGGGGCCCGGCCGTGCGACATTTCCCGAATTCTGCA
G
GTATCCAACGGTTGTGTGAGTAAAATTCTGGGCAGGTATTACGAGACTGGCTCCATCAGACCCAGGGCA
ATC
GGAGGGAGTAAGCCAAGAGTGGCGACTCCAGAAGTTGTAAGCAAAATAGCCCAGTATAAACGGGAGT
GC
CCTTCCATCTTTGCTTGGGAAATCCGAGACAGATTATTATCCGAGGGGGTCTGTACCAACGATAACAT
A
CCCAGTGTGTCATCAATAAACAGAGTTCTTCGCAACCTGGCTAGCGAAAAGCAACAGATGGGCGCAGAC
GGC
ATGTATGATAAACTAAGGATGTTGAACGGGCAGACCGGAAGCTGGGGCACACGCCCTGGTTGGTATC
CC
GGGACTTCAGTACCAGGGCAACCCACGCAAGATGGCTGCCAGCAACAGGAAGGAGGGGGAGAGAACAC
C
AACTCCATCAGTTCTAACGGAGAAGACTCGGATGAAGCTCAGATGCGACTTCAGCTGAAGCGGAAGCTG
CAA
AGAAATAGAACATCTTTTACCCAAGAGCAGATTGAGGCTCTGGAGAAAGAGTTTGAGAGGACCCATT
AT
CCAGATGTGTTTGCCCGGGAAAGACTAGCAGCCAAAATAGATCTACCTGAAGCAAGAATACAGGTATG
G
TTTTCTAATCGAAGGGCCAAATGGAGAAGAGAAGAGAAACTGAGGAACCAGAGAAGACAGGCCAGCAAC
ACT
CCTAGTCACATTCCTATCAGCAGCAGCTTCAGTACCAGTGTCTACCAGCCAATCCCACAGCCCACCA
CA
CCTGTCTCCTCCTTCACATCAGGTTCCATGTTGGGCCGAACAGACACCGCCCTCACCAACACGTACAG
T
GCTTTGCCACCCATGCCCAGCTTCACCATGGCAAACAACCTGCCTATGCAACCCCCAGTCCCCAGTCAG
ACC
TCCTCATACTCGTGCATGCTGCCCACCAGCCCGTCAGTGAATGGGCGGAGTTATGATACCTACACCC
CT
CCGCACATGCAAACACACATGAACAGTCAGCCCATGGGCACCTCGGGGACCACTTCAACAGGACTCAT
T
TCACCTGGAGTGTCAGTTCCCGTCCAAGTTCCCGGGAGTGAACCTGACATGTCTCAGTACTGGCCTCGA
TTA
CAGTAA


Translation (422 aa):
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRA
I
GGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPS
VSSINRVLRNLASEKQQMGAD
G
MYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQ
DGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKL
Q
RNRTSFTQEQIEALEK
EFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASN
T
PSHIPISSSFSTSVYQPIPQPTTP
VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQ
T
SSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTST
GLISPGVSVPVQVPGSEPDMSQYWPR
L
Q




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser