NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50729.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50729.1 Public Mus musculus 2 Plcb1 16 104 75 CCDS HistoryNCBI Gene:18795Re-query CCDS DB by CCDS ID:50729.1Re-query CCDS DB by GeneID:18795

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50729.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110116 ENSMUSP00000105743 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110116Link to Ensembl Protein Viewer:ENSMUSP00000105743Re-query CCDS DB by Nucleotide ID:ENSMUST00000110116Re-query CCDS DB by Protein ID:ENSMUSP00000105743
Original member Current member EBI,WTSI OTTMUST00000037031 OTTMUSP00000016610 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037031Link to Vega Protein Viewer:OTTMUSP00000016610Re-query CCDS DB by Nucleotide ID:OTTMUST00000037031Re-query CCDS DB by Protein ID:OTTMUSP00000016610
Original member Current member NCBI NM_001145830.1 NP_001139302.1 Accepted alive Link to Nucleotide Sequence:NM_001145830.1Link to Protein Sequence:NP_001139302.1Re-query CCDS DB by Nucleotide ID:NM_001145830Re-query CCDS DB by Protein ID:NP_001139302Link to BLink:NP_001139302.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139302.1 1216 Q9Z1B3-1 1216 100% 0 0

Chromosomal Locations for CCDS 50729.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 134786533 134786631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 134813601 134813678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 134988124 134988192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135220718 135220855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135249971 135250050 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135251733 135251786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135252775 135252850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135260499 135260599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135262108 135262274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135294849 135294995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135310921 135311078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135317786 135317868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135322610 135322694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135325623 135325800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135330300 135330367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135333348 135333444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135335428 135335512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135337437 135337561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135340660 135340814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135344158 135344322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135345023 135345122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135346297 135346401 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135347367 135347476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135359654 135359786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135362384 135362437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135364768 135364987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135370421 135370601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135386094 135386170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135386273 135386362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135387136 135387193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135387798 135387884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135472053 135472280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3651 nt):
ATGGCTGGGGCTCAGCCCGGAGTGCACGCCTTGCAACTCAAGCCCGTGTGCGTGTCCGACAGCCTCAAGA
AG
GGCACCAAATTCGTCAAGTGGGATGATGACTCCACTATTGTTACTCCAATTATTTTGAGGACTGATCC
T
CAGGGATTTTTCTTTTACTGGACAGACCAGAATAAGGAGACGGAGCTGTTAGATCTCAGCCTTGTCAAG
GAT
GCCAGGTGTGGGAAGCACGCCAAAGCTCCCAAGGACCCCAAGTTGCGTGAACTTCTGGATGTTGGGA
AC
ATCGGACACTTGGAACAGCGCATGATAACTGTGGTGTATGGACCAGACCTGGTGAACATTTCCCACTT
G
AATCTTGTGGCTTTTCAAGAGGAAGTAGCCAAGGAATGGACAAATGAGGTTTTCAGCTTGGCAACAAAC
CTG
CTGGCTCAGAACATGTCCAGGGACGCATTTCTGGAGAAAGCATATACTAAGCTCAAGCTCCAGGTCA
CC
CCAGAAGGCCGCATTCCTCTTAAAAACATCTATCGATTGTTCTCAGCAGACCGGAAGCGCGTTGAAAC
T
GCACTAGAGGCTTGTAGTCTTCCATCTTCGAGGAATGACTCCATTCCCCAAGAGGACTTCACTCCAGAT
GTA
TACAGAGTTTTCCTGAACAATCTCTGTCCCCGACCTGAAATTGATAACATCTTTTCTGAATTTGGTG
CC
AAAAGCAAACCGTACCTGACGGTTGATCAGATGATGGATTTTATCAACCTTAAGCAGAGAGATCCCCG
G
CTCAATGAAATCCTTTACCCACCTCTGAAGCAGGAGCAGGTCCAAGTGTTGATTGAGAAATATGAGCCC
AAC
AGCAGCCTCGCCAAGAAAGGGCAGATGTCAGTGGATGGATTCATGCGCTACCTGAGCGGAGAAGAAA
AT
GGAGTCGTTTCACCTGAGAAACTGGATTTGAACGAAGACATGTCTCAGCCCCTGTCTCACTATTTCAT
C
AATTCCTCGCACAACACCTACCTCACAGCTGGCCAGTTGGCTGGGAACTCGTCTGTAGAGATGTATCGC
CAG
GTGCTTCTGTCTGGATGTCGCTGTGTGGAGCTGGACTGCTGGAAGGGAAGGACCGCTGAGGAAGAGC
CT
GTCATTACCCATGGATTCACCATGACAACAGAAATATCCTTCAAGGAAGTCATAGAAGCCATCGCAGA
G
TGTGCGTTCAAGACGTCTCCTTTCCCCATCCTCCTTTCCTTTGAGAACCACGTGGATTCCCCGAAGCAA
CAA
GCCAAGATGGCCGAGTATTGCCGATTAATCTTTGGTGATGCCCTCCTGATGGAACCACTGGAAAAAT
AC
CCACTGGAATCTGGGGTACCTCTTCCAAGCCCTATGGATTTAATGTATAAAATCTTGGTGAAAAACAA
G
AAGAAGTCGCACAAGTCGTCAGAGGGAAGTGGTAAGAAGAAGCTTTCAGAGCAAGCTTCCAACACCTAC
AGC
GACTCCTCCAGTGTGTTCGAGCCTTCGTCTCCAGGAGCTGGGGAAGCAGATACGGAGAGTGATGACG
AT
GACGACGACGATGACTGTAAAAAGTCTTCCATGGATGAGGGGACAGCTGGCAGCGAAGCCATGGCCAC
A
GAAGAGATGTCTAACCTGGTGAACTATATTCAGCCTGTCAAGTTTGAGTCCTTTGAAATTTCAAAAAAA
AGA
AATAAAAGCTTTGAAATGTCTTCCTTCGTGGAAACCAAAGGACTTGAACAACTTACAAAGTCTCCGG
TG
GAATTTGTAGAATACAACAAGATGCAACTTAGCAGGATATATCCCAAGGGAACACGTGTGGATTCATC
C
AACTACATGCCTCAACTCTTCTGGAATGCTGGCTGTCAGATGGTGGCGCTCAACTTCCAGACAGTGGAT
CTA
GCTATGCAGATAAACATGGGCATGTATGAGTACAATGGGAAGAGCGGCTATAGGCTGAAGCCAGAGT
TC
ATGAGGAGGCCGGACAAGCATTTTGATCCATTTACTGAAGGAATCGTAGATGGGATAGTGGCCAACAC
T
CTATCTGTTAAGATTATTTCAGGTCAGTTCCTCTCTGATAAGAAAGTTGGGACTTATGTGGAAGTGGAT
ATG
TTTGGCTTGCCTGTGGACACAAGGAGGAAGGCATTTAAAACCAAGACATCCCAAGGAAATGCTGTAA
AC
CCTGTCTGGGAAGAAGAACCTATTGTATTCAAAAAGGTAGTTCTACCTTCTCTGGCCTGTTTGAGGAT
A
GCAGCATATGAAGAGGGAGGCAAATTTATTGGCCACCGGATATTGCCTGTGCAGGCTATTCGGCCAGGC
TAT
CACTACATCTGCCTGCGGAATGAGAGGAACCAGCCCCTGACGCTGCCAGCTGTCTTTGTCTACATAG
AA
GTCAAAGATTATGTGCCAGACACGTATGCAGATGTAATCGAAGCTCTATCAAACCCAATCCGATATGT
C
AATCTGATGGAACAGAGAGCTAAGCAGCTGGCTGCGTTGACCCTGGAGGATGAAGAGGAAGTAAAGAAG
GAG
GCTGACCCTGGAGAAACATCTTCCGAGGCTCCAAGCGAAACCAGGACAACGCCAGCAGAGAATGGGG
TG
AATCACACCGCATCCCTTGCACCCAAGCCGCCTTCCCAGGCTCCACACAGCCAGCCTGCTCCAGGGTC
T
GTGAAGGCACCTGCCAAAACAGAAGATCTGATCCAGAGCGTGTTAACAGAAGTAGAGGCGCAAACCATC
GAA
GAGCTCAAGCAACAGAAATCGTTCGTGAAACTTCAAAAGAAACACTACAAAGAAATGAAAGACCTGG
TG
AAGAGACACCACAAGAAAACCACGGAGCTCATTAAGGAGCACACGACCAAGTACAACGAGATTCAGAA
T
GACTACCTGAGAAGGAGGGCAGCCTTGGAGAAGTCCGCCAAAAAGGACAGCAAGAAGAAATCTGAACCC
AGC
AGCCCTGACCACGGCTCATCAGCCATTGAGCAAGACCTCGCTGCCCTGGATGCAGAAATGACTCAGA
AG
TTGATAGACTTGAAAGACAAGCAACAACAGCAGCTGCTTAATCTTCGGCAAGAGCAGTATTACAGCGA
G
AAGTACCAAAAGCGAGAACACATTAAACTGCTTATTCAGAAGTTGACAGATGTTGCAGAAGAGTGTCAG
AAC
AATCAGTTAAAGAAGCTGAAGGAAATCTGCGAGAAAGAGAAGAAGGAATTAAAGAAGAAAATGGATA
AG
AAGAGGCAAGAGAAGATAACAGAAGCCAAGTCCAAAGACAAAAGCCAGATGGAAGAGGAGAAGACAGA
G
ATGATCCGATCGTACATCCAGGAGGTGGTTCAGTACATCAAGAGGTTAGAGGAAGCACAAAGTAAAAGA
CAA
GAAAAACTCGTGGAGAAACACAATGAGATCCGCCAGCAGATCCTCGATGAGAAGCCCAAGCTGCAGA
CG
GAGCTGGAGCAAGAATACCAAGACAAGTTCAAAAGGCTGCCCCTGGAGATTCTGGAGTTTGTACAGGA
A
GCCATGAAAGGGAAGATCAGCGAGGACAGCAATCACGGCTCTGCCCCTCCCTCTCTGGCCTCAGATGCT
GCA
AAGGTGAACCTCAAGTCTCCCTCCAGTGAGGAGATAGAAAGAGAGAACCCAGGAAGAGAGTTTGATA
CT
CCTCTGTGA


Translation (1216 aa):
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVK
D
ARCGKHAKAPK
DPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATN
L
LAQNMSRDAFLEK
AYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPD
V
YRVFLNNLCPRPEIDNIFSE
FGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEP
N
SSLAKK
GQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYR
Q
VLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFK
EVIEAIAECAFKTSPFPILLSFENHVDSPKQ
Q
AKMAEYCRLIFGDALLMEPLEKYP
LESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTY
S
DSSSVFEPSSPGA
GEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKK
R
NKSFEMSSFVETKGLEQLTKSPVEFV
EYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVD
L
AMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVK
IISGQFLSDKKVGTYVEVD
M
FGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKK
VVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPG
Y
HYICLRNERNQPLTLPAVFVYIEVKDYVPDTYA
DVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
E
ADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTI
E
ELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKK
KSEP
S
SPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKL
LIQKLTDVAEECQ
N
NQLKKLKEICE
KEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKR
Q
EKLVEKHNEIRQQILDEKPK
LQTELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPPSLASDA
A
KVNLKSPSSEEIERENPGREFDTPL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser