NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49810.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49810.1 Public Mus musculus 16 Trp63 16 104 75 CCDS HistoryNCBI Gene:22061Re-query CCDS DB by CCDS ID:49810.1Re-query CCDS DB by GeneID:22061See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49810.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000065523 ENSMUSP00000067005 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000065523Link to Ensembl Protein Viewer:ENSMUSP00000067005Re-query CCDS DB by Nucleotide ID:ENSMUST00000065523Re-query CCDS DB by Protein ID:ENSMUSP00000067005
Original member Current member NCBI NM_001127260.1 NP_001120732.1 Accepted alive Link to Nucleotide Sequence:NM_001127260.1Link to Protein Sequence:NP_001120732.1Re-query CCDS DB by Nucleotide ID:NM_001127260Re-query CCDS DB by Protein ID:NP_001120732Link to BLink:NP_001120732.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001120732.1 555 O88898-3 555 100% 0 0

Chromosomal Locations for CCDS 49810.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 25684290 25684351 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25763266 25763394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25764164 25764296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25820388 25820642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25862279 25862465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25863675 25863790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25865247 25865356 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25866075 25866211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25868167 25868249 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25870997 25871133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25882527 25882684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25884811 25884955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 25889008 25889023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1668 nt):
ATGAATTTTGAAACTTCACGGTGTGCCACCCTACAGTACTGCCCCGACCCTTACATCCAGCGTTTCATAG
AA
ACCCCAGCTCATTTCTCGTGGAAAGAAAGTTATTACAGATCTGCCATGTCGCAGAGCACCCAGACAAG
C
GAGTTCCTCAGCCCAGAGGTCTTCCAGCATATCTGGGATTTTCTGGAACAGCCTATATGCTCAGTACAG
CCC
ATCGAGTTGAACTTTGTGGATGAACCTTCCGAAAATGGTGCAACAAACAAGATTGAGATTAGCATGG
AT
TGTATCCGCATGCAAGACTCAGACCTCAGTGACCCCATGTGGCCACAGTACACGAACCTGGGGCTCCT
G
AACAGCATGGACCAGCAGATTCAGAACGGCTCCTCGTCCACCAGCCCCTACAACACAGACCACGCACAG
AAT
AGCGTGACGGCGCCCTCGCCCTATGCACAGCCCAGCTCCACCTTTGATGCCCTCTCTCCATCCCCTG
CC
ATTCCCTCCAACACAGATTACCCGGGCCCACACAGCTTCGATGTGTCCTTCCAGCAGTCAAGCACTGC
C
AAGTCAGCCACCTGGACGTATTCCACCGAACTGAAGAAGCTGTACTGCCAGATTGCGAAGACATGCCCC
ATC
CAGATCAAGGTGATGACCCCACCCCCACAGGGCGCTGTTATCCGTGCCATGCCTGTCTACAAGAAAG
CT
GAGCATGTCACCGAGGTTGTGAAACGATGCCCTAACCATGAGCTGAGCCGTGAGTTCAATGAGGGACA
G
ATTGCCCCTCCCAGTCATCTGATTCGAGTAGAAGGGAACAGCCATGCCCAGTATGTAGAAGATCCTATC
ACG
GGAAGGCAGAGCGTGCTGGTCCCTTATGAGCCACCACAGGTTGGCACTGAATTCACAACAGTCCTGT
AC
AATTTCATGTGTAACAGCAGCTGCGTCGGAGGAATGAACAGACGTCCAATTTTAATCATCGTTACTCT
G
GAAACCAGAGATGGGCAAGTCCTGGGCCGACGGTGCTTTGAGGCCCGGATCTGTGCTTGCCCAGGAAGA
GAC
CGGAAGGCAGATGAAGACAGCATCAGAAAGCAGCAAGTATCGGACAGCGCAAAGAACGGCGATGGTA
CG
AAGCGCCCTTTCCGTCAGAATACACACGGAATCCAGATGACTTCCATCAAGAAACGGAGATCCCCAGA
T
GATGAGCTGCTGTACCTACCAGTGAGAGGTCGTGAGACGTACGAGATGTTGCTGAAGATCAAAGAGTCA
CTG
GAGCTCATGCAGTACCTCCCTCAGCACACGATCGAAACGTACAGGCAGCAGCAGCAGCAGCAGCACC
AG
CACCTACTTCAGAAACAGACCTCGATGCAGTCTCAGTCTTCATATGGCAACAGTTCCCCACCTCTGAA
C
AAAATGAACAGCATGAACAAGCTGCCTTCCGTGAGCCAGCTTATCAACCCACAGCAGCGCAATGCCCTC
ACT
CCCACCACCATGCCTGAGGGCATGGGAGCCAACATTCCTATGATGGGCACTCACATGCCAATGGCTG
GA
GACATGAATGGACTCAGCCCTACCCAAGCTCTCCCTCCTCCACTCTCCATGCCCTCCACCTCCCACTG
C
ACCCCACCACCGCCCTACCCCACAGACTGCAGCATTGTCAGGATTTGGCAAGTCTGA


Translation (555 aa):
MNFETSRCATLQYCPDPYIQRFIETPAHFSWKESYYRSAMSQSTQTSEFLSPEVFQHIWDFLEQPICSVQ
P
IELNFVDEPSENGATNKIEISMDCIRMQDSDLSDPMW
PQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQ
N
SVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWT
YSTELKKLYCQIAKTCP
I
QIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNE
GQIAPPSHLIRVEGNSHAQYVEDPI
T
GRQSVLVPYEPPQ
VGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR
D
RKADEDSIRKQQVSDSAKNGDGTKR
PFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
L
ELMQYLPQHTIETYRQQQQQQHQHLLQK
QTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNAL
T
PTTMPEGMGAN
IPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVRIWQV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser