NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51644.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51644.1 Public Mus musculus 5 P2rx7 16 104 75 CCDS HistoryNCBI Gene:18439Re-query CCDS DB by CCDS ID:51644.1Re-query CCDS DB by GeneID:18439

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51644.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000121489 ENSMUSP00000112440 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121489Link to Ensembl Protein Viewer:ENSMUSP00000112440Re-query CCDS DB by Nucleotide ID:ENSMUST00000121489Re-query CCDS DB by Protein ID:ENSMUSP00000112440
Original member Current member EBI,WTSI OTTMUST00000066138 OTTMUSP00000033091 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000066138Link to Vega Protein Viewer:OTTMUSP00000033091Re-query CCDS DB by Nucleotide ID:OTTMUST00000066138Re-query CCDS DB by Protein ID:OTTMUSP00000033091
Original member Current member NCBI NM_001038839.2 NP_001033928.1 Accepted alive Link to Nucleotide Sequence:NM_001038839.2Link to Protein Sequence:NP_001033928.1Re-query CCDS DB by Nucleotide ID:NM_001038839Re-query CCDS DB by Protein ID:NP_001033928Link to BLink:NP_001033928.1

Chromosomal Locations for CCDS 51644.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 122644074 122644198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122652727 122652895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122654161 122654229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122657012 122657084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122658708 122658804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122663577 122663657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122664545 122664674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122666144 122666280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122670438 122670528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122673355 122673420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122673666 122673815 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122676662 122676763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122683175 122683180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1296 nt):
ATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGTATGAGACAAACAAAGTCACCCGGATCCAGAGCA
CG
AATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAGCTTTGCTTTGGTGAG
C
GATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAG
GTG
ACGGAGAATGTCACAGAGGGTGGGGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACA
CC
TTCCCTTTGCAGGGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGAAGGCCAAGTGCAGAC
G
CTGTGTCCTGAGTATCCCAGGCGCGGTGCACAGTGCTCTTCTGACCGGCGTTGTAAAAAGGGGTGGATG
GAC
CCACAGAGCAAAGGAATCCAGACTGGCAGGTGTGTTCCATATGACAAGACAAGGAAGACCTGTGAAG
TC
TCTGCCTGGTGTCCTACTGAGGAGGAGAAAGAAGCTCCCCGACCTGCACTCTTGAGGAGCGCCGAAAA
C
TTCACCGTACTCATCAAGAATAATATCCACTTCCCCGGCCACAACTATACCACGAGAAACATCTTGCCA
ACT
ATGAACGGCTCTTGTACCTTTCACAAGACTTGGGACCCTCAGTGTTCCATCTTCCGACTAGGGGACA
TC
TTCCAGGAAGCAGGAGAGAACTTTACAGAGGTGGCAGTTCAGGGAGGAATCATGGGTATCGAGATCTA
C
TGGGATTGCAACCTAGACAGCTGGTCCCATCACTGCCGACCCAGGTACAGCTTCCGCCGCCTGGATGAC
AAG
AACACGGATGAGTCCTTCGTCCCCGGCTACAACTTCAGATATGCCAAGTACTATAAGGAGAACAATG
TG
GAAAAGCGGACGTTGATCAAAGCCTTCGGCATCCGTTTTGACATCCTGGTTTTCGGCACTGGAGGAAA
A
TTTGACATCATCCAGCTGGTTGTATACATTGGATCCACCCTGTCCTACTTTGGCTTGGCCACTGTGTGC
ATT
GACTTGCTCATCAACACATACTCCAGTGCTTTCTGCAGGTCGGGGGTTTACCCCTACTGTAAGTGCT
GT
GAGCCCTGCACAGTGAACGAGTATTACTACAGAAAGAAGTGTGAGTCCATCATGGAACCCAAGCCGAC
G
TTGAAGTATGTGTCCTTTGTCGACGAGCCGCACATTCGCATGGTGGACCAGCAGCTGCTTGGGAAAAGT
CTG
CAAGTTGTCAAAGGCCAAGAAGTTCCAACCTAG


Translation (431 aa):
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISSVHTKVKGIAE
V
TENVTEGGVTKLGHSIFDTADYTFPLQ
GNSFFVMTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWM
D
PQSK
GIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILP
T
MNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQ
GGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDD
K
NTDESFVPGYNF
RYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVC
I
DLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKP
TLKYVSFVDEPHIRMVDQQLLGKS
L
QVVKGQEVP
T



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser