NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27535.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27535.1 Public Mus musculus 15 Cyp11b1 16 104 75 CCDS HistoryNCBI Gene:110115Re-query CCDS DB by CCDS ID:27535.1Re-query CCDS DB by GeneID:110115See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27535.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000170259 ENSMUSP00000127888 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170259Link to Ensembl Protein Viewer:ENSMUSP00000127888Re-query CCDS DB by Nucleotide ID:ENSMUST00000170259Re-query CCDS DB by Protein ID:ENSMUSP00000127888
Original member Current member NCBI NM_001033229.3 NP_001028401.2 Accepted alive Link to Nucleotide Sequence:NM_001033229.3Link to Protein Sequence:NP_001028401.2Re-query CCDS DB by Nucleotide ID:NM_001033229Re-query CCDS DB by Protein ID:NP_001028401Link to BLink:NP_001028401.2

Chromosomal Locations for CCDS 27535.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 74835753 74835866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74836233 74836421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74836509 74836587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74836820 74836986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74838494 74838645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74838905 74839108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74839227 74839426 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74840810 74840965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74841368 74841612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1506 nt):
ATGACAATGGCTCTCAGGGTGACAACAGATGTGTGGCTGGCAAGACCCTGGCAGTGCCTGCACAGGACAA
GG
GCACTGGGCACCACGGCAACACTGGCCCCAAAGACCCTGCAGCCCTTTGAAGCCATACCACAGTACTC
C
AGGAACAAGTGGCTGAAGATGATACAGATCCTGAGGGAGCAGGGCCAAGAAAACCTACACCTGGAGATG
CAT
CAGGTCTTCCGGGAGCTGGGGCCCATTTTCAGGCACAGTGTAGGGAAAACACAGATTGTGTTTGTGA
CG
TTGCCGGAGGATGTTGAGAAGCTGTACCAGGTAGAGAGTACGCACCCTTGCCGCATGCCCTTGGAATC
C
TGGATAGTCCATAGAGAACTCCGTGGCCTGGGACGTGGTGTGTTCTTGCTAAATGGGCCAGAATGGTAC
TTC
AACCGACTGCAGCTGAACCCAAATGTTCTGTCACCAAAAGCCGTTCAAAAATTTGTCCCCTTGGTGG
AT
GGGATAGCAAGGGACTTTGTGGATAACCTGAAGAAGAAAATGCTGGAAAGTGTCCATGGTAGCTTCTC
T
ATGGACTTTCAGTCCAGTGTGTTCAACTATACCATAGAAGCTAGCCACTTTGTTCTTTTTGGGGAGCGG
CTG
GGCCTCATTGGCCGTGATCTGAGCCCTGACAGCCTGAAGTTCCTCCACACCCTGCACTCCATGTTCA
AA
ACCACCACACAGCTCTTGTACTTGCCCAGGAGCCTGACCCGATGGACAAGCACCAGGGTGTGGAAAGA
A
AACTTAGAGTCCTGGGATTTCATCTCTGAATATGTCACCAAATGTATCAAGAATGTGTATCGAGAGCTG
GCA
GAGGGTCGTCCACAGTCCTGGAGTGTCACAGCAGAGCTGGTAGCTGAGAGAACTCTGTCAATGGATG
CC
ATCCAGGCTAACTCAATGGAACTCATTGCTGGAAGCACTGACACGACATCAACCCCCTTGGTAATGAC
T
TTCTTTGAGCTGGCTCGGAACCCAGATGTTCAGCAGGCCCTGAGGCAGGAGAGCCTGGCAGCTGAGGCC
AGC
ATCGCTGCAAATCCTCAGAAGGCCATGTCAGACCTGCCCTTGCTGAGGGCTGCCCTTAAAGAGACCT
TG
AGGCTCTATCCTGTTGGTACTTTTCTGGAGAGAATTCTAAGCTCAGACTTGGTGCTTCAGAACTACCA
T
GTCCCTGCTGGGACAGTCCTCAATGTGAATCTGTATTCCATGGGCCGGAACCCTGCAGTGTTCCCAAGG
CCT
GAACGCTATATGCCTCAGCGCTGGCTGGAGAGGAAAAGGAGTTTCAAGCACCTGGCCTTTGGCTTTG
GG
GTGCGCCAGTGCCTGGGGAGGCGCCTGGCAGAGGCAGAGATGATGCTCCTGCTTCACCATGTGCTGAA
A
TCCTTCCACGTGGAGACACAAGAGAAAGAGGATGTGCGGATGGCCTACCGCTTCGTTTTGATGCCCAGC
TCC
AGTCCTCTCCTCACTTTCAGGCCTGTCAACTAG


Translation (501 aa):
MTMALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEM
H
QVFRELGPIF
RHSVGKTQIVFVTLPEDVEKLYQVESTHPCRMPLESWIVHRELRGLGRGVFLLNGPEWY
F
NRLQLNPNVLSPKAVQKFVPLVDGIARDFVDNLKKKMLESVHGSFSMDFQSSVFNYTIE
ASHFVLFGER
L
GLIGRDLSPDSLKFLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLESWDFISEY
VTKCIKNVYREL
A
EGRPQSWSVTAELVAERTLSMDAIQANSMELIAGSTDT
TSTPLVMTFFELARNPDVQQALRQESLAAEA
S
IAANPQKAMSDLPLLRAALKETL
RLYPVGTFLERILSSDLVLQNYHVPAGTVLNVNLYSMGRNPAVFPR
P
ERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEMMLLLHH
VLKSFHVETQEKEDVRMAYRFVLMPS
S
SPLLTFRPVN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser