NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22304.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22304.1 Public Mus musculus 8 Aga 16 104 75 CCDS HistoryNCBI Gene:11593Re-query CCDS DB by CCDS ID:22304.1Re-query CCDS DB by GeneID:11593

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22304.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033920 ENSMUSP00000033920 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033920Link to Ensembl Protein Viewer:ENSMUSP00000033920Re-query CCDS DB by Nucleotide ID:ENSMUST00000033920Re-query CCDS DB by Protein ID:ENSMUSP00000033920
Original member Current member NCBI NM_001005847.2 NP_001005847.1 Accepted alive Link to Nucleotide Sequence:NM_001005847.2Link to Protein Sequence:NP_001005847.1Re-query CCDS DB by Nucleotide ID:NM_001005847Re-query CCDS DB by Protein ID:NP_001005847Link to BLink:NP_001005847.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001005847.1 346 Q64191 346 100% 0 0

Chromosomal Locations for CCDS 22304.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

Chromosome Start Stop Links
8 53511805 53511931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53513542 53513695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53514237 53514349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53515944 53516056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53517754 53517868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53518916 53518991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53520237 53520344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53521050 53521183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 53523176 53523276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1041 nt):
ATGGAGCGGAAGTCGAATCTGTCTCTGCTTCTCCTACTGCTGGTCCTGGGCATGCCCCTGGTGCGGGGCT
CC
AGCCCTCTGCCCCTGGTCGTCAACACTTGGCCTTTTAAGAATGCCACTGAAGCAGCGTGGTGGACATT
G
CTATCTGGAGGTTCTGCCCTGGATGCAGTGGAGAACGGCTGTGCTGTGTGTGAGAAGGAGCAGTGTGAT
GGG
ACTGTAGGCTTTGGAGGAAGTCCTGATGAAGGTGGCGAAACCACCCTGGATGCCATGATAATGGATG
G
C
ACTGCCATGGATGTGGGAGCAGTGGGAGGCCTTAGAAGAATTAAAAACGCGATTGGCGTGGCGCGGAG
A
GTCCTGGAGCATACCACACACACGCTTTTAGTGGGGGACTCAGCCACCAAGTTTGCTGAAAGTATGGGG
TTT
ACTAATGAGGACTTGTCTACCAAAACCTCAAGAGATCTTCATTCAGATTGGCTTTCTCGAAATTGCC
AG
CCAAATTATTGGAGAAATGTTATTCCAGATCCCTCAAAATACTGTGGACCCTACAAACCATCTGGTTT
C
TTAAAGCAGAGTATTTCTCCCCACAAAGAAGAAGTGGATATCCACAGCCATGATACTATTGGCATGGTT
GTA
ATCCATAAGACGGGACATACTGCTGCTGGCACATCCACAAATGGTATAAAATTCAAAATACCTGGTC
GT
GTAGGGGATTCACCAATCCCTGGAGCCGGAGCCTATGCTGATGACACGGCTGGAGCAGCTGCAGCCAC
T
GGCGATGGTGACACACTCCTGCGCTTTCTGCCGAGCTACCAAGCTGTAGAATATATGAGAGGAGGAGAT
GAC
CCAGCCATAGCTTGCCAAAAAGTGATTTTAAGAATTCAGAAATACTATCCAAACTTCTTTGGAGCGG
TC
ATATGTGCCAGTGTGAACGGAAGTTATGGTGCTGCTTGCAACAAACTTCCAACATTTACACAATTTAG
T
TTCATGGTTTCTAATTCTTTACACAATGAGCCAACCGAAAAAAAAGTAGACTGCATCTAA


Translation (346 aa):
MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCD
G
TVGFGGSPDEGGETTLDAMIMD
GTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMG
F
TNEDLSTKTSRDLHSDWLSRNCQPNYWR
NVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIGMV
V
IHKTGHTAAGTSTNGIKFKIP
GRVGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGD
D
PAIACQKVILRIQKYYPNFFGAVICASVNGSY
GAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser