NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14503.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14503.1 Public Homo sapiens X NXF3 17 106 76 CCDS HistoryNCBI Gene:56000Re-query CCDS DB by CCDS ID:14503.1Re-query CCDS DB by GeneID:56000See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 14503.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000395065 ENSP00000378504 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395065Link to Ensembl Protein Viewer:ENSP00000378504Re-query CCDS DB by Nucleotide ID:ENST00000395065Re-query CCDS DB by Protein ID:ENSP00000378504
Original member Current member EBI,WTSI OTTHUMT00000057684 OTTHUMP00000023726 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000057684Link to Vega Protein Viewer:OTTHUMP00000023726Re-query CCDS DB by Nucleotide ID:OTTHUMT00000057684Re-query CCDS DB by Protein ID:OTTHUMP00000023726
Original member Current member NCBI NM_022052.1 NP_071335.1 Accepted alive Link to Nucleotide Sequence:NM_022052.1Link to Protein Sequence:NP_071335.1Re-query CCDS DB by Nucleotide ID:NM_022052Re-query CCDS DB by Protein ID:NP_071335Link to BLink:NP_071335.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_071335.1 531 Q9H4D5-1 531 100% 0 0

Chromosomal Locations for CCDS 14503.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 103076290 103076301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103077614 103077746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103078560 103078632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103079221 103079263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103079359 103079474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103079584 103079642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103079763 103079870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103080013 103080068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103080148 103080216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103080576 103080612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103082255 103082364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103082760 103082848 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103083004 103083073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103083193 103083273 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103083398 103083502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103083609 103083692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103084342 103084495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103084715 103084883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103092996 103093023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1596 nt):
ATGTCACTGCCTTCAGGACACACTACGGGTCACACTGATCAAGTTGTTCAAAGAAGAGCAAGATGTTGGG
AT
ATTTACCAAAGGAGATTTAGCAGTAGGTCTGAACCTGTCAATCCTGGCATGCATTCTTCATCCCATCA
G
CAGCAAGATGGAGATGCAGCAATGCATGGTGCCCACATGGACTCTCCAGTAAGATACACTCCCTATACT
ATT
TCACCCTATAATCGGAAAGGCAGTTTTCGTAAACAAGACCAAACCCACGTTAACATGGAGAGAGAGC
AA
AAACCTCCAGAGAGAAGAATGGAGGGGAACATGCCGGATGGGACCTTAGGGAGCTGGTTCAAGATCAC
A
GTTCCCTTTGGCATAAAATACAATGAGAAGTGGCTGCTGAATTTGATTCAGAATGAATGCAGTGTACCC
TTC
GTCCCAGTTGAGTTTCACTATGAAAACATGCATGCCAGCTTCTTTGTGGAGAATGCCAGCATCGCCT
AT
GCACTGAAGAATGTCAGTGGCAAGATTTGGGATGAGGATAATGAAAAGATATCAATCTTTGTCAACCC
T
GCTGGCATACCCCACTTTGTGCACAGGGAGCTGAAGTCAGAAAAGGTGGAGCAGATAAAGCTGGCCATG
AAC
CAACAGTGTGATGTCTCCCAGGAAGCTCTTGATATCCAGAGACTCCCATTTTACCCAGACATGGTGA
AC
CGTGATACTAAGATGGCATCGAATCCTAGAAAGTGCATGGCTGCCTCCCTGGACGTCCATGAAGAGAA
C
ATACCTACAGTGATGTCTGCAGGGGAGATGGACAAGTGGAAAGGGATAGAGCCAGGAGAGAAGTGTGCG
GAC
AGAAGCCCAGTGTGCACGACCTTCTCGGATACCTCCAGCAACATAAACTCCATCCTGGAATTGTTCC
CC
AAATTATTATGCCTGGATGGCCAGCAGTCACCCAGAGCAACTTTATGTGGTACTGAAGCCCACAAGAG
G
TTACCAACCTGTAAGGGAAGCTTCTTTGGATCTGAGATGTTGAAGAATCTGGTCCTGCAATTCCTGCAG
CA
G
TATTACTTGATCTATGACTCTGGAGATCGACAGGGTCTCCTTAGTGCTTACCACGATGAGGCCTGCT
TC
TCCCTGAGCATTCCCTTCAATCCTGAGGACTCAGCCCCGAGCAGCTTCTGCAAGTTCTTCAAGGATAG
C
AGGAATATAAAAATTCTCAAGGACCCCTACCTTCGGGGGGAGCTGCTGAAGCACACAAAACTTGATATT
GTG
GACTCCCTCAGTGCGTTGCCTAAAACTCAGCATGACCTCAGCTCCTTCCTGGTGGACATGTGGTACC
AG
ACGGAATGGATGCTCTGCTTTTCTGTCAACGGGGTGTTCAAGGAAGTGGAAGGACAGTCTCAGGGTTC
T
GTTCTCGCCTTCACCCGGACCTTCATTGCTACCCCTGGCAGCAGTTCCAGTCTGTGCATCGTGAATGAC
AAG
CTCTTTGTGCGGGATACCAGCCACCAAGGGACCCAGAGTGCCTTGTTCACCCTAGTGCCCACAGCCT
TC
TCCAGCTCCGTGCCTGCCTTCTCCCAGGAGCAGCAGAAAATGCTGCCTTCGTAA


Translation (531 aa):
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYT
I
SPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKIT
VPFGIKYNEKWLLNLIQNECSVP
F
VPVE
FHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAM
N
QQCDVSQEALDIQRLPFYP
DMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCA
D
RSPVCTTFSDTSSNI
NSILELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ
Q
YYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI
V
DSLSALPKTQHDLSSFLVDMWYQT
EWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVND
K
LFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKM
LPS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser