NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24439.1 Public Mus musculus 11 Ddc 16 104 75 CCDS HistoryNCBI Gene:13195Re-query CCDS DB by CCDS ID:24439.1Re-query CCDS DB by GeneID:13195

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000066237 ENSMUSP00000068525 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066237Link to Ensembl Protein Viewer:ENSMUSP00000068525Re-query CCDS DB by Nucleotide ID:ENSMUST00000066237Re-query CCDS DB by Protein ID:ENSMUSP00000068525
Original member Current member EBI,WTSI ENSMUST00000109659 ENSMUSP00000105286 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109659Link to Ensembl Protein Viewer:ENSMUSP00000105286Re-query CCDS DB by Nucleotide ID:ENSMUST00000109659Re-query CCDS DB by Protein ID:ENSMUSP00000105286
Original member Current member EBI,WTSI ENSMUST00000178704 ENSMUSP00000136467 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178704Link to Ensembl Protein Viewer:ENSMUSP00000136467Re-query CCDS DB by Nucleotide ID:ENSMUST00000178704Re-query CCDS DB by Protein ID:ENSMUSP00000136467
Original member Current member EBI,WTSI OTTMUST00000011540 OTTMUSP00000005369 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011540Link to Vega Protein Viewer:OTTMUSP00000005369Re-query CCDS DB by Nucleotide ID:OTTMUST00000011540Re-query CCDS DB by Protein ID:OTTMUSP00000005369
Original member Current member NCBI NM_001190448.1 NP_001177377.1 Accepted alive Link to Nucleotide Sequence:NM_001190448.1Link to Protein Sequence:NP_001177377.1Re-query CCDS DB by Nucleotide ID:NM_001190448Re-query CCDS DB by Protein ID:NP_001177377Link to BLink:NP_001177377.1
Original member Current member NCBI NM_016672.4 NP_057881.1 Accepted alive Link to Nucleotide Sequence:NM_016672.4Link to Protein Sequence:NP_057881.1Re-query CCDS DB by Nucleotide ID:NM_016672Re-query CCDS DB by Protein ID:NP_057881Link to BLink:NP_057881.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001177377.1 480 O88533 480 100% 0 0
NP_057881.1 480 O88533 480 100% 0 0

Chromosomal Locations for CCDS 24439.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 11815228 11815428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11819291 11819392 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11822195 11822293 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11824849 11824868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11829102 11829178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11835742 11835809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11839398 11839492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11846636 11846702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11863651 11863794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11864894 11865028 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11873134 11873253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11876245 11876358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 11880442 11880642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1443 nt):
ATGGATTCCCGTGAATTCCGGAGGAGAGGCAAGGAGATGGTGGATTATATAGCTGACTATCTGGATGGCA
TT
GAGGGTCGTCCAGTGTACCCTGATGTGGAGCCTGGCTATCTTCGGCCCCTGATCCCTGCCACTGCCCC
C
CAGGAGCCAGAAACATACGAGGACATAATCAAAGACATCGAGAAGATAATCATGCCAGGGGTGACACAC
TGG
CACAGTCCCTATTTCTTCGCTTACTTCCCCACGGCTAGCTCATACCCAGCTATGCTTGCAGACATGC
TG
TGTGGTGCTATTGGCTGCATTGGTTTCTCCTGGGCTGCAAGCCCAGCGTGCACAGAGCTGGAGACCGT
G
ATGATGGACTGGCTGGGGAAGATGCTGGAGCTGCCAGAGGCCTTTTTGGCTGGAAGAGCTGGGGAAGGG
GGA
GGAGTGATCCAGGGAAGTGCCAGTGAAGCCACCTTGGTGGCCCTACTGGCTGCTCGGACTAAAGTTA
TC
CGCCAGCTGCAGGCAGCCTCCCCAGAGTTCACACAAGCTGCTATCATGGAAAAGCTGGTTGCTTACAC
A
TCTGATCAGGCGCATTCCTCTGTAGAAAGAGCTGGGTTAATTGGTGGAATAAAGCTAAAAGCAGTCCCT
TCG
GATGGCAACTTTTCCATGAGAGCTTCTGCCCTTCGGGAAGCCCTGGAGCGGGACAAGGCAGCTGGCC
TG
ATTCCATTCTTTGTGGTCGCTACACTGGGGACCACATCCTGCTGTTCTTTTGACAATCTCCTGGAAGT
G
GGTCCCATCTGCAACCAGGAGGGTGTGTGGCTGCACATTGACGCTGCTTACGCGGGCAGTGCCTTTATC
TGT
CCTGAATTCCGGTATCTTCTGAATGGTGTGGAGTTTGCAGATTCCTTTAACTTTAATCCCCACAAGT
GG
CTTTTGGTGAACTTTGACTGCTCTGCCATGTGGGTGAAGAGGAGGACTGACTTAACCGGAGCCTTTAA
T
ATGGACCCTGTTTATCTAAAGCACAGTCACCAGGACTCAGGATTCATCACTGACTACAGGCACTGGCAG
ATC
CCACTGGGGCGACGATTTCGCTCTTTGAAAATGTGGTTTGTTTTTAGAATGTACGGAGTCAAGGGGC
TG
CAGGCTTACATCCGAAAGCACGTGGAGCTGTCTCATGAGTTTGAGTCACTGGTACGCCAGGACCCTCG
C
TTTGAAATTTGCACAGAAGTCATTCTTGGGTTGGTCTGCTTCCGGCTAAAGGGCTCCAATGAGTTGAAC
GAA
ACTCTCTTACAAAGAATAAACAGCGCCAAAAAAATCCACTTGGTTCCATGTCGTCTCCGAGACAAGT
TT
GTGCTACGCTTTGCTGTGTGCGCTCGCACTGTGGAGTCTGCCCACGTGCAGCTGGCCTGGGAACACAT
C
AGTGATCTAGCAAGCAGTGTGCTGAGGGCAGAGAAAGAATGA


Translation (480 aa):
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTH
W
HSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSW
AASPACTELETVMMDWLGKMLELPEAFLAGRAGEG
G
GVIQ
GSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVP
S
DGNFSMRASALREALERDKAAGLIPFF
VVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFI
C
PEFRYLLNGVE
FADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQ
I
PLGRRFRSLKMWFVFRMYGVKGLQAYIRK
HVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELN
E
TLLQRINSAKKIHLVPCRLRDKFVLRFAVCARTVESAHVQLAWEHISDLASSVLRAEKE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser