NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28608.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28608.1 Public Mus musculus 17 Pknox1 16 104 75 CCDS HistoryNCBI Gene:18771Re-query CCDS DB by CCDS ID:28608.1Re-query CCDS DB by GeneID:18771See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28608.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000097352 ENSMUSP00000094966 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000097352Link to Ensembl Protein Viewer:ENSMUSP00000094966Re-query CCDS DB by Nucleotide ID:ENSMUST00000097352Re-query CCDS DB by Protein ID:ENSMUSP00000094966
Original member Current member EBI,WTSI ENSMUST00000175806 ENSMUSP00000134852 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000175806Link to Ensembl Protein Viewer:ENSMUSP00000134852Re-query CCDS DB by Nucleotide ID:ENSMUST00000175806Re-query CCDS DB by Protein ID:ENSMUSP00000134852
Original member Current member EBI,WTSI ENSMUST00000176701 ENSMUSP00000135804 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000176701Link to Ensembl Protein Viewer:ENSMUSP00000135804Re-query CCDS DB by Nucleotide ID:ENSMUST00000176701Re-query CCDS DB by Protein ID:ENSMUSP00000135804
Original member Current member EBI,WTSI OTTMUST00000104191 OTTMUSP00000058285 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000104191Link to Vega Protein Viewer:OTTMUSP00000058285Re-query CCDS DB by Nucleotide ID:OTTMUST00000104191Re-query CCDS DB by Protein ID:OTTMUSP00000058285
Original member Current member EBI,WTSI OTTMUST00000104193 OTTMUSP00000058286 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000104193Link to Vega Protein Viewer:OTTMUSP00000058286Re-query CCDS DB by Nucleotide ID:OTTMUST00000104193Re-query CCDS DB by Protein ID:OTTMUSP00000058286
Original member Current member EBI,WTSI OTTMUST00000104194 OTTMUSP00000058287 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000104194Link to Vega Protein Viewer:OTTMUSP00000058287Re-query CCDS DB by Nucleotide ID:OTTMUST00000104194Re-query CCDS DB by Protein ID:OTTMUSP00000058287
Original member Current member NCBI NM_016670.3 NP_057879.2 Accepted alive Link to Nucleotide Sequence:NM_016670.3Link to Protein Sequence:NP_057879.2Re-query CCDS DB by Nucleotide ID:NM_016670Re-query CCDS DB by Protein ID:NP_057879Link to BLink:NP_057879.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057879.2 436 O70477 436 100% 0 0

Chromosomal Locations for CCDS 28608.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 31583753 31583803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31588460 31588587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31590603 31590774 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31592105 31592275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31595225 31595324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31596796 31596893 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31599515 31599643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31602786 31602862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31603187 31603359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 31604753 31604964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1311 nt):
ATGATGGCGACACAGACGCTAAGTATAGACAGCTATCAAGATGGACAGCAAATGCAGGTGGTCACGGAGT
TA
AAAACAGAGCAAGATCCCAACTGCTCTGACCCAGATGCAGAAGGAGTGAGTCCTCCTCCCATCGAGTC
T
CAGACCCCAATGGATGCCGACAAGCAGGCCATTTATAGGCATCCACTATTTCCGTTGCTAGCTTTGTTG
TTT
GAGAAGTGTGAGCAGTCCACACAGGGCTCAGAAGGCACGACGTCTGCCAGCTTCGATGTGGACATTG
AG
AACTTTGTCAGGAAGCAAGAAAAGGATGGGAAACCCTTCTTCTGTGAAGATCCGGAAACTGACAACCT
A
ATGGTGAAAGCAATCCAGGTCCTGCGCATTCATCTTCTTGAACTGGAGAAGGTTAATGAGCTCTGTAAA
GAT
TTCTGTAGTCGGTACATTGCTTGTCTGAAGACAAAAATGAACAGCGAGACCTTGTTGAGTGGGGAGC
CT
GGAAGTCCGTACTCCCCTGTGCAATCCCAGCAGATTCAGAGTGCCATCACAGGCACGCTCAGCCCCCA
G
GGAATCGTGGTGCCAGCATCAGCCCTACAACAGGGAAATGTAACCATGGCAACAGTGGCAGGTGGCACA
GTG
TACCAGCCTGTCACCGTCGTCACTCCGCAAGGCCAAGTGGTCACGCAGGCATTATCTCCTGGGACAA
TT
AGGATCCAGAACTCACAGCTGCAGTTGCAGTTGAACCAAGACCTCAGCATCTTGCATCAAGAGGATGG
C
TCCTCCAAGAACAAGAGGGGTGTCCTGCCGAAGCACGCCACCAACGTGATGCGGTCCTGGCTCTTTCAG
CAC
ATAGGGCATCCCTACCCAACAGAGGATGAGAAAAAGCAGATTGCTGCTCAGACGAATCTGACCCTGC
TT
CAAGTCAACAACTGGTTCATCAACGCGAGAAGACGAATTCTCCAGCCAATGTTGGATTCCAGCTGCTC
A
GAGACTCCAAAAACGAAGAAAAAACCTGCTCAGAACAGGCCAGTTCAGAGGTTTTGGCCAGATTCTCTT
GCA
TCAGGAGTGGCACAAGCAACACCCAGCGAGCTTGCCATGTCAGAAGGTGCCGTTGTGACCATCACCA
CA
CCTGTAAACATGAATGTGGACAGCCTTCAGTCCCTGTCCTCAGACGGGGCCACCCTGGCCGTACAGCA
G
GTCATGATGGCAGGGCAGAGTGAGGACGAGTCGGTGGATAGCACAGAGGATGAGGGCGGCGCCCTGGCG
CCC
ACACACATCAGCGGGCTGGTGCTGGAGAACAGCGACTCCCTTCAGTAG


Translation (436 aa):
MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPIESQTPMDADKQAIYRHPLFPLLALL
F
EKCEQSTQGSEGTTSASFDVDIENFVRKQEKDGKPFFCEDPETDNL
MVKAIQVLRIHLLELEKVNELCK
D
FCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQ
QIQSAITGTLSPQGIVVPASALQQGNVTMATVAGGT
V
YQPVTVVTPQGQVVTQALSPGTIRIQNSQ
LQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQ
H
IG
HPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSL
A
SGVAQATPSELAMSE
GAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEDEGGALA
P
THISGLVLENSDSLQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser